Detailed information of TA system TA259102

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): stbDE/ParE-DnaT
• Location: 19496..20027
• Replicon: plasmid unnamed2
• Accession: NZ_CP104747
• Organism: Erwinia pyrifoliae strain CP20113301

Toxin (Protein)

• Gene name: stbE
• Uniprot ID: E3DL65
• Locus tag: NYP80_RS19545
• Protein ID: WP_011078058.1
• Coordinates: 19496..19783 (-)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: stbD
• Uniprot ID: Q7X3U3
• Locus tag: NYP80_RS19550
• Protein ID: WP_011078059.1
• Coordinates: 19773..20027 (-)
• Length: 85 a.a.

Genomic Context

Location: 23824..24408 (585 bp)
Type: Others
Protein ID: WP_012814636.1

Location: 15996..17552 (1557 bp)
Type: Others
Protein ID: WP_041473953.1

Location: 18060..18473 (414 bp)
Type: Others
Protein ID: WP_011113999.1

Location: 18474..18788 (315 bp)
Type: Others
Protein ID: WP_261648176.1

Location: 19052..19336 (285 bp)
Type: Others
Protein ID: WP_011078079.1

Location: 19496..19783 (288 bp)
Type: Toxin
Protein ID: WP_011078058.1

Location: 19773..20027 (255 bp)
Type: Antitoxin
Protein ID: WP_011078059.1

Location: 20238..21203 (966 bp)
Type: Others
Protein ID: WP_011078060.1

Location: 21219..21977 (759 bp)
Type: Others
Protein ID: WP_012814638.1

Location: 21981..22178 (198 bp)
Type: Others
Protein ID: WP_012814637.1

Location: 22175..23107 (933 bp)
Type: Others
Protein ID: WP_041473952.1

Location: 23483..23644 (162 bp)
Type: Others
Protein ID: Protein_27

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NYP80_RS19525 (NYP80_19525)	15996..17552	-	1557	WP_041473953.1	methyl-accepting chemotaxis protein	-
NYP80_RS19530 (NYP80_19530)	18060..18473	-	414	WP_011113999.1	helix-turn-helix domain-containing protein	-
NYP80_RS19535 (NYP80_19535)	18474..18788	-	315	WP_261648176.1	type II toxin-antitoxin system HigB family toxin	-
NYP80_RS19540 (NYP80_19540)	19052..19336	-	285	WP_011078079.1	VF530 family DNA-binding protein	-
NYP80_RS19545 (NYP80_19545)	19496..19783	-	288	WP_011078058.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NYP80_RS19550 (NYP80_19550)	19773..20027	-	255	WP_011078059.1	plasmid stabilization protein	Antitoxin
NYP80_RS19555 (NYP80_19555)	20238..21203	-	966	WP_011078060.1	ThiF family adenylyltransferase	-
NYP80_RS19560 (NYP80_19560)	21219..21977	-	759	WP_012814638.1	thiazole synthase	-
NYP80_RS19565 (NYP80_19565)	21981..22178	-	198	WP_012814637.1	sulfur carrier protein ThiS	-
NYP80_RS19570 (NYP80_19570)	22175..23107	-	933	WP_041473952.1	FAD-dependent oxidoreductase	-
NYP80_RS19575 (NYP80_19575)	23483..23644	-	162	Protein_27	Txe/YoeB family addiction module toxin	-
NYP80_RS19580 (NYP80_19580)	23824..24408	+	585	WP_012814636.1	recombinase family protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_004445 Erwinia pyrifoliae Ep1/96 Non-Mobilizable plasmid TA006130 1..35904 0.004	inside	Non-Mobilizable plasmid	-	pla	1..34637	34637
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_004445 Erwinia pyrifoliae Ep1/96 IS/Tn TA006130 17120..17704 0.001	flank	IS/Tn	-	-	23824..24408	584

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-85)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 11197.09 Da
• Isoelectric Point: 10.6516

>T259102 WP_011078058.1 NZ_CP104747:c19783-19496 [Erwinia pyrifoliae]
MTYKLKFVPSAEKEWKRLGHPVREQFKKKLAERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQEHTITIMVMGIGK
REGNQIYSDTENRLP

Nucleotide

• Length: 288 bp

Antitoxin

Protein

• Length: 85 a.a.
• Molecular weight: 9210.56 Da
• Isoelectric Point: 3.8705

>AT259102 WP_011078059.1 NZ_CP104747:c20027-19773 [Erwinia pyrifoliae]
MAFNILTNTAASITDLKRDPMGTVRAAEGETIAILNRNEPAFYCVPPAMYAYLMELAEDAELGCIVDDRMSELPVAKEIS
LDDL

Nucleotide

• Length: 255 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: E3DL65

Antitoxin

Loading, please wait

• AlphaFold DB: Q7X3U3