Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 956225..957039 | Replicon | chromosome |
Accession | NZ_CP104677 | ||
Organism | Salmonella enterica strain PNUSAS036471 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | N4534_RS04580 | Protein ID | WP_000971655.1 |
Coordinates | 956225..956752 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | N4534_RS04585 | Protein ID | WP_000855694.1 |
Coordinates | 956749..957039 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4534_RS04550 (952507) | 952507..952905 | + | 399 | Protein_890 | cytoplasmic protein | - |
N4534_RS04555 (953096) | 953096..953335 | + | 240 | Protein_891 | hypothetical protein | - |
N4534_RS04560 (953492) | 953492..954160 | + | 669 | WP_000445914.1 | hypothetical protein | - |
N4534_RS04565 (954187) | 954187..954681 | + | 495 | WP_000424948.1 | hypothetical protein | - |
N4534_RS04570 (954853) | 954853..955509 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
N4534_RS04575 (955742) | 955742..956152 | + | 411 | Protein_895 | transposase | - |
N4534_RS04580 (956225) | 956225..956752 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
N4534_RS04585 (956749) | 956749..957039 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
N4534_RS04590 (957309) | 957309..957487 | - | 179 | Protein_898 | IS3 family transposase | - |
N4534_RS04595 (957728) | 957728..958054 | + | 327 | WP_000393302.1 | hypothetical protein | - |
N4534_RS04600 (958327) | 958327..958674 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
N4534_RS04605 (958659) | 958659..959108 | - | 450 | WP_000381610.1 | membrane protein | - |
N4534_RS04610 (959540) | 959540..959983 | - | 444 | WP_000715099.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
N4534_RS04615 (960439) | 960439..961089 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 954853..966402 | 11549 | ||
- | flank | IS/Tn | - | - | 955928..956152 | 224 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T258948 WP_000971655.1 NZ_CP104677:c956752-956225 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |