258846

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 848285..848510 Replicon chromosome
Accession NZ_CP104649
Organism Escherichia coli strain PNUSAE008512

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag N5913_RS04510 Protein ID WP_000813258.1
Coordinates 848285..848440 (-) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 848452..848510 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5913_RS04460 843288..843719 - 432 WP_001302123.1 tellurite resistance protein -
N5913_RS04475 844170..844883 - 714 WP_000301797.1 helix-turn-helix domain-containing protein -
N5913_RS04480 845019..845216 - 198 WP_000917763.1 hypothetical protein -
N5913_RS04485 845441..845995 - 555 WP_000640035.1 DUF1133 family protein -
N5913_RS04490 846058..846363 - 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
N5913_RS04495 846376..847425 - 1050 WP_001265229.1 DUF968 domain-containing protein -
N5913_RS04500 847427..847699 - 273 WP_000191872.1 hypothetical protein -
N5913_RS04505 847821..848165 - 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
N5913_RS04510 848285..848440 - 156 WP_000813258.1 Hok/Gef family protein Toxin
- 848452..848510 + 59 - - Antitoxin
N5913_RS04515 848731..849288 - 558 WP_000104474.1 DUF551 domain-containing protein -
N5913_RS04520 849290..849508 - 219 WP_000683609.1 DUF4014 family protein -
N5913_RS04525 849636..849947 - 312 WP_001289673.1 hypothetical protein -
N5913_RS04530 849940..850167 - 228 WP_000699809.1 hypothetical protein -
N5913_RS04535 850164..850445 - 282 WP_000603384.1 DNA-binding protein -
N5913_RS04540 850478..851194 - 717 WP_000450627.1 DUF1627 domain-containing protein -
N5913_RS04545 851228..851689 - 462 WP_000139447.1 replication protein P -
N5913_RS04550 851682..852725 - 1044 WP_001262402.1 DnaT-like ssDNA-binding domain-containing protein -
N5913_RS04555 852794..853219 - 426 WP_000693878.1 toxin YdaT family protein -
N5913_RS04560 853203..853445 - 243 WP_000747948.1 Cro/CI family transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 817838..909175 91337


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T258846 WP_000813258.1 NZ_CP104649:c848440-848285 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT258846 NZ_CP104649:848452-848510 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References