Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 848285..848510 | Replicon | chromosome |
| Accession | NZ_CP104649 | ||
| Organism | Escherichia coli strain PNUSAE008512 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | N5913_RS04510 | Protein ID | WP_000813258.1 |
| Coordinates | 848285..848440 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 848452..848510 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5913_RS04460 | 843288..843719 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| N5913_RS04475 | 844170..844883 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| N5913_RS04480 | 845019..845216 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| N5913_RS04485 | 845441..845995 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| N5913_RS04490 | 846058..846363 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| N5913_RS04495 | 846376..847425 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| N5913_RS04500 | 847427..847699 | - | 273 | WP_000191872.1 | hypothetical protein | - |
| N5913_RS04505 | 847821..848165 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| N5913_RS04510 | 848285..848440 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| - | 848452..848510 | + | 59 | - | - | Antitoxin |
| N5913_RS04515 | 848731..849288 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| N5913_RS04520 | 849290..849508 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| N5913_RS04525 | 849636..849947 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| N5913_RS04530 | 849940..850167 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| N5913_RS04535 | 850164..850445 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| N5913_RS04540 | 850478..851194 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| N5913_RS04545 | 851228..851689 | - | 462 | WP_000139447.1 | replication protein P | - |
| N5913_RS04550 | 851682..852725 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
| N5913_RS04555 | 852794..853219 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
| N5913_RS04560 | 853203..853445 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | nleG7' | 817838..909175 | 91337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T258846 WP_000813258.1 NZ_CP104649:c848440-848285 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT258846 NZ_CP104649:848452-848510 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|