Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1347727..1348526 | Replicon | chromosome |
| Accession | NZ_CP104639 | ||
| Organism | Escherichia coli strain PNUSAE014970 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | N4555_RS06630 | Protein ID | WP_000347273.1 |
| Coordinates | 1348062..1348526 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | C3ST72 |
| Locus tag | N4555_RS06625 | Protein ID | WP_001302819.1 |
| Coordinates | 1347727..1348062 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4555_RS06610 (1343512) | 1343512..1344282 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| N4555_RS06615 (1344298) | 1344298..1345632 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| N4555_RS06620 (1346007) | 1346007..1347578 | + | 1572 | WP_001273776.1 | galactarate dehydratase | - |
| N4555_RS06625 (1347727) | 1347727..1348062 | + | 336 | WP_001302819.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| N4555_RS06630 (1348062) | 1348062..1348526 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| N4555_RS06635 (1348581) | 1348581..1349390 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| N4555_RS06640 (1349639) | 1349639..1350919 | + | 1281 | WP_000681927.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| N4555_RS06645 (1350942) | 1350942..1351415 | + | 474 | WP_001301475.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| N4555_RS06650 (1351426) | 1351426..1352205 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| N4555_RS06655 (1352195) | 1352195..1353073 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| N4555_RS06660 (1353091) | 1353091..1353525 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1338373..1348526 | 10153 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T258713 WP_000347273.1 NZ_CP104639:1348062-1348526 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|