Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 1000680..1001494 | Replicon | chromosome |
| Accession | NZ_CP104491 | ||
| Organism | Salmonella enterica strain SalSpp_sample_05_No.1 | ||
Toxin (Protein)
| Gene name | TacT3 | Uniprot ID | Q57KM2 |
| Locus tag | N4229_RS04760 | Protein ID | WP_000971655.1 |
| Coordinates | 1000680..1001207 (-) | Length | 176 a.a. |
Antitoxin (Protein)
| Gene name | TacA3 | Uniprot ID | M7S6I2 |
| Locus tag | N4229_RS04765 | Protein ID | WP_000855694.1 |
| Coordinates | 1001204..1001494 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4229_RS04730 (996980) | 996980..997378 | + | 399 | Protein_927 | cytoplasmic protein | - |
| N4229_RS04735 (997569) | 997569..997808 | + | 240 | Protein_928 | hypothetical protein | - |
| N4229_RS04740 (997965) | 997965..998633 | + | 669 | WP_000445914.1 | hypothetical protein | - |
| N4229_RS04745 (998660) | 998660..999154 | + | 495 | WP_020899151.1 | hypothetical protein | - |
| N4229_RS04750 (999399) | 999399..1000055 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
| N4229_RS04755 (1000402) | 1000402..1000607 | + | 206 | Protein_932 | IS5/IS1182 family transposase | - |
| N4229_RS04760 (1000680) | 1000680..1001207 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
| N4229_RS04765 (1001204) | 1001204..1001494 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
| N4229_RS04770 (1001764) | 1001764..1001953 | - | 190 | Protein_935 | IS3 family transposase | - |
| N4229_RS04775 (1002194) | 1002194..1002520 | + | 327 | WP_050067855.1 | hypothetical protein | - |
| N4229_RS04780 (1002793) | 1002793..1003140 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
| N4229_RS04785 (1003125) | 1003125..1003574 | - | 450 | WP_050067853.1 | hypothetical protein | - |
| N4229_RS04790 (1004006) | 1004006..1004449 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
| N4229_RS04795 (1004906) | 1004906..1005556 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1000431..1010869 | 10438 | ||
| - | flank | IS/Tn | - | - | 1000431..1000607 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T258112 WP_000971655.1 NZ_CP104491:c1001207-1000680 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 6G96 | |
| PDB | 7AK9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3V8SJE7 |