Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ralRA/- |
Location | 2573889..2574260 | Replicon | chromosome |
Accession | NZ_CP104309 | ||
Organism | Escherichia coli O157:H7 strain 380-94 |
Toxin (Protein)
Gene name | ralR | Uniprot ID | A0A0D6ZRD3 |
Locus tag | NUE46_RS12930 | Protein ID | WP_001443846.1 |
Coordinates | 2574111..2574260 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | ralA | ||
Locus tag | - | ||
Coordinates | 2573889..2574067 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUE46_RS12900 (2569641) | 2569641..2569811 | + | 171 | WP_001625136.1 | protein YnaL | - |
NUE46_RS12905 (2569844) | 2569844..2571217 | + | 1374 | WP_000123746.1 | ATP-dependent RNA helicase DbpA | - |
NUE46_RS12910 (2571346) | 2571346..2572281 | - | 936 | WP_001157407.1 | tRNA 2-thiocytidine(32) synthetase TtcA | - |
NUE46_RS12915 (2572333) | 2572333..2573568 | - | 1236 | WP_000040839.1 | site-specific integrase | - |
NUE46_RS12920 (2573570) | 2573570..2573785 | - | 216 | WP_000079604.1 | excisionase XisR | - |
- (2573889) | 2573889..2574067 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2573889) | 2573889..2574067 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2573889) | 2573889..2574067 | + | 179 | NuclAT_0 | - | Antitoxin |
- (2573889) | 2573889..2574067 | + | 179 | NuclAT_0 | - | Antitoxin |
NUE46_RS12925 (2573885) | 2573885..2574073 | - | 189 | WP_001302840.1 | DUF1187 family protein | - |
NUE46_RS12930 (2574111) | 2574111..2574260 | - | 150 | WP_001443846.1 | type I toxin-antitoxin system endodeoxyribonuclease toxin RalR | Toxin |
NUE46_RS12935 (2574316) | 2574316..2575125 | - | 810 | WP_000166313.1 | recombination protein RecT | - |
NUE46_RS12940 (2575118) | 2575118..2577718 | - | 2601 | WP_000105140.1 | exodeoxyribonuclease VIII | - |
NUE46_RS12945 (2577820) | 2577820..2578095 | - | 276 | WP_001344816.1 | hypothetical protein | - |
NUE46_RS12950 (2578170) | 2578170..2578340 | - | 171 | WP_001352098.1 | YdaE family protein | - |
NUE46_RS12955 (2578340) | 2578340..2578561 | - | 222 | WP_000560223.1 | killing protein KilR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2560070..2621485 | 61415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5383.12 Da Isoelectric Point: 8.3398
>T257540 WP_001443846.1 NZ_CP104309:c2574260-2574111 [Escherichia coli O157:H7]
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
MRYDNVKPCPFCGCPSVTVKAISGYYRAKCNGCESRTGYGGSEKEALER
Download Length: 150 bp
Antitoxin
Download Length: 179 bp
>AT257540 NZ_CP104309:2573889-2574067 [Escherichia coli O157:H7]
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
GAGGACTGAAGTTTCTCGCAATTAAAATTTATCAGTTTTACTTTCTGCTCTCTGGAAACGCCTGCTTCTTTTTTACCTGA
GAGCATTTTTTCGCATTCTGATTTCGTTAGTTTAGATTTTGAATATCTTGTCCAGTTAGTAGGAGTGCCACCTTCCTTTT
CAATAGTGGCGGTAATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|