Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1869642..1870254 | Replicon | chromosome |
Accession | NZ_CP104025 | ||
Organism | Erwinia amylovora strain Ea915 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | D2TUP9 |
Locus tag | MTP51_RS08315 | Protein ID | WP_012906750.1 |
Coordinates | 1870075..1870254 (-) | Length | 60 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | D4I356 |
Locus tag | MTP51_RS08310 | Protein ID | WP_004157632.1 |
Coordinates | 1869642..1870052 (-) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTP51_RS08280 (MTP51_08280) | 1865300..1865890 | - | 591 | WP_223386180.1 | DapH/DapD/GlmU-related protein | - |
MTP51_RS08285 (MTP51_08285) | 1866520..1866792 | + | 273 | WP_004157637.1 | hypothetical protein | - |
MTP51_RS08290 (MTP51_08290) | 1866803..1866976 | + | 174 | WP_013036045.1 | hypothetical protein | - |
MTP51_RS08295 (MTP51_08295) | 1867071..1867244 | + | 174 | WP_004157636.1 | hypothetical protein | - |
MTP51_RS08300 (MTP51_08300) | 1867502..1867714 | + | 213 | WP_004157635.1 | hypothetical protein | - |
MTP51_RS08305 (MTP51_08305) | 1868585..1869586 | - | 1002 | WP_004157633.1 | acyltransferase | - |
MTP51_RS08310 (MTP51_08310) | 1869642..1870052 | - | 411 | WP_004157632.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
MTP51_RS08315 (MTP51_08315) | 1870075..1870254 | - | 180 | WP_012906750.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
MTP51_RS08320 (MTP51_08320) | 1870774..1871502 | - | 729 | WP_004157629.1 | two-component system response regulator RstA | - |
MTP51_RS08325 (MTP51_08325) | 1871679..1872143 | + | 465 | WP_004157626.1 | hypothetical protein | - |
MTP51_RS08330 (MTP51_08330) | 1872147..1873538 | - | 1392 | WP_004157625.1 | amino acid permease | - |
MTP51_RS08335 (MTP51_08335) | 1873746..1874696 | - | 951 | WP_004157624.1 | DUF1471 family protein YdgH | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1866154..1893676 | 27522 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6644.85 Da Isoelectric Point: 10.9132
>T257036 WP_012906750.1 NZ_CP104025:c1870254-1870075 [Erwinia amylovora]
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
MDSRNAIAMIEADGWYLVRVKGSHHQFKHPTKKGLVTVKHPQKDIPLPTLKSIKKQAGL
Download Length: 180 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 14829.76 Da Isoelectric Point: 4.3623
>AT257036 WP_004157632.1 NZ_CP104025:c1870052-1869642 [Erwinia amylovora]
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
MLYPVAIDKGDSSFGVRVPDIPGCFSGGDNYQDAIESAREAIDAHIELLVEDGEAVPEATSVENWLADPDYVGVVWALVD
VDVTRLMGKAEKINVTLPSLLIRRIDQFVAAHPEYGSRSGFLSRVAADKVIGREKR
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D6XDK4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A830ZVY0 |