Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
Location | 1929495..1930084 | Replicon | chromosome |
Accession | NZ_CP104022 | ||
Organism | Erwinia amylovora strain Ea102 |
Toxin (Protein)
Gene name | doc | Uniprot ID | D4I2L7 |
Locus tag | MTP49_RS08525 | Protein ID | WP_004157545.1 |
Coordinates | 1929495..1929866 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | D4I2L6 |
Locus tag | MTP49_RS08530 | Protein ID | WP_004157544.1 |
Coordinates | 1929863..1930084 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MTP49_RS08510 (MTP49_08510) | 1925376..1925825 | + | 450 | WP_004157563.1 | DUF4385 domain-containing protein | - |
MTP49_RS08515 (MTP49_08515) | 1925910..1926545 | - | 636 | WP_004157562.1 | carbonic anhydrase | - |
MTP49_RS08520 (MTP49_08520) | 1926671..1928611 | - | 1941 | WP_004157559.1 | methyl-accepting chemotaxis protein | - |
MTP49_RS08525 (MTP49_08525) | 1929495..1929866 | - | 372 | WP_004157545.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
MTP49_RS08530 (MTP49_08530) | 1929863..1930084 | - | 222 | WP_004157544.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
MTP49_RS08535 (MTP49_08535) | 1930877..1932349 | + | 1473 | WP_004157542.1 | catalase | - |
MTP49_RS08540 (MTP49_08540) | 1932436..1933185 | - | 750 | WP_004157541.1 | 5'-nucleotidase, lipoprotein e(P4) family | - |
MTP49_RS08545 (MTP49_08545) | 1933309..1933785 | - | 477 | WP_004157540.1 | GNAT family N-acetyltransferase | - |
MTP49_RS08550 (MTP49_08550) | 1933898..1934107 | - | 210 | WP_004157539.1 | glycine zipper 2TM domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 1929495..1945756 | 16261 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13667.70 Da Isoelectric Point: 7.4182
>T257028 WP_004157545.1 NZ_CP104022:c1929866-1929495 [Erwinia amylovora]
MIYFLSSQDIIGIHQRMIVAYGGLAGYADPGRIESMATRILNRHIYEGEDDIYILAAAYLLAIARGHCFNDANKRTAFAS
TALFLRRNGILLRFSPIHEQLTVSAAQGSLDVWHIAEALKQST
MIYFLSSQDIIGIHQRMIVAYGGLAGYADPGRIESMATRILNRHIYEGEDDIYILAAAYLLAIARGHCFNDANKRTAFAS
TALFLRRNGILLRFSPIHEQLTVSAAQGSLDVWHIAEALKQST
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | D4I2L7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A831A2K1 |