Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1328666..1329465 | Replicon | chromosome |
| Accession | NZ_CP103864 | ||
| Organism | Escherichia coli O157:H7 strain RV06 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | V0SSH7 |
| Locus tag | NUE47_RS06555 | Protein ID | WP_000347273.1 |
| Coordinates | 1329001..1329465 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | C3ST72 |
| Locus tag | NUE47_RS06550 | Protein ID | WP_001302819.1 |
| Coordinates | 1328666..1329001 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUE47_RS06535 (1324451) | 1324451..1325221 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| NUE47_RS06540 (1325237) | 1325237..1326571 | - | 1335 | WP_000599636.1 | galactarate/glucarate/glycerate transporter GarP | - |
| NUE47_RS06545 (1326946) | 1326946..1328517 | + | 1572 | WP_001273776.1 | galactarate dehydratase | - |
| NUE47_RS06550 (1328666) | 1328666..1329001 | + | 336 | WP_001302819.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| NUE47_RS06555 (1329001) | 1329001..1329465 | + | 465 | WP_000347273.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| NUE47_RS06560 (1329520) | 1329520..1330329 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| NUE47_RS06565 (1330578) | 1330578..1331858 | + | 1281 | WP_000681927.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| NUE47_RS06570 (1331881) | 1331881..1332354 | + | 474 | WP_001301475.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| NUE47_RS06575 (1332365) | 1332365..1333144 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| NUE47_RS06580 (1333134) | 1333134..1334012 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| NUE47_RS06585 (1334030) | 1334030..1334464 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Genomic island | - | - | 1319312..1329465 | 10153 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17836.25 Da Isoelectric Point: 9.6924
>T256849 WP_000347273.1 NZ_CP103864:1329001-1329465 [Escherichia coli O157:H7]
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
MDFPQRVNGWALYAHPCFQETYDALVAEVETLKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWETLTRETEETH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|