Detailed information of TA system TA255056

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): stbDE/ParE-DnaT
• Location: 19503..20034
• Replicon: plasmid unnamed
• Accession: NZ_CP103446
• Organism: Erwinia pyrifoliae strain CP201486

Toxin (Protein)

• Gene name: stbE
• Uniprot ID: E3DL65
• Locus tag: NYP84_RS19385
• Protein ID: WP_011078058.1
• Coordinates: 19503..19790 (-)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: stbD
• Uniprot ID: Q7X3U3
• Locus tag: NYP84_RS19390
• Protein ID: WP_011078059.1
• Coordinates: 19780..20034 (-)
• Length: 85 a.a.

Genomic Context

Location: 23831..24415 (585 bp)
Type: Others
Protein ID: WP_259818180.1

Location: 16003..17559 (1557 bp)
Type: Others
Protein ID: WP_041473953.1

Location: 18067..18480 (414 bp)
Type: Others
Protein ID: WP_011113999.1

Location: 18481..18795 (315 bp)
Type: Others
Protein ID: WP_041473956.1

Location: 19059..19343 (285 bp)
Type: Others
Protein ID: WP_011078079.1

Location: 19503..19790 (288 bp)
Type: Toxin
Protein ID: WP_011078058.1

Location: 19780..20034 (255 bp)
Type: Antitoxin
Protein ID: WP_011078059.1

Location: 20245..21210 (966 bp)
Type: Others
Protein ID: WP_011078060.1

Location: 21226..21984 (759 bp)
Type: Others
Protein ID: WP_012814638.1

Location: 21988..22185 (198 bp)
Type: Others
Protein ID: WP_012814637.1

Location: 22182..23114 (933 bp)
Type: Others
Protein ID: WP_041473952.1

Location: 23490..23651 (162 bp)
Type: Others
Protein ID: Protein_26

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NYP84_RS19365 (NYP84_19365)	16003..17559	-	1557	WP_041473953.1	methyl-accepting chemotaxis protein	-
NYP84_RS19370 (NYP84_19370)	18067..18480	-	414	WP_011113999.1	helix-turn-helix domain-containing protein	-
NYP84_RS19375 (NYP84_19375)	18481..18795	-	315	WP_041473956.1	type II toxin-antitoxin system HigB family toxin	-
NYP84_RS19380 (NYP84_19380)	19059..19343	-	285	WP_011078079.1	VF530 family DNA-binding protein	-
NYP84_RS19385 (NYP84_19385)	19503..19790	-	288	WP_011078058.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
NYP84_RS19390 (NYP84_19390)	19780..20034	-	255	WP_011078059.1	plasmid stabilization protein	Antitoxin
NYP84_RS19395 (NYP84_19395)	20245..21210	-	966	WP_011078060.1	ThiF family adenylyltransferase	-
NYP84_RS19400 (NYP84_19400)	21226..21984	-	759	WP_012814638.1	thiazole synthase	-
NYP84_RS19405 (NYP84_19405)	21988..22185	-	198	WP_012814637.1	sulfur carrier protein ThiS	-
NYP84_RS19410 (NYP84_19410)	22182..23114	-	933	WP_041473952.1	FAD-dependent oxidoreductase	-
NYP84_RS19415 (NYP84_19415)	23490..23651	-	162	Protein_26	Txe/YoeB family addiction module toxin	-
NYP84_RS19420 (NYP84_19420)	23831..24415	+	585	WP_259818180.1	recombinase family protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_004445 Erwinia pyrifoliae Ep1/96 Non-Mobilizable plasmid TA006130 1..35904 0.005	inside	Non-Mobilizable plasmid	-	pla	1..34668	34668
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_004445 Erwinia pyrifoliae Ep1/96 IS/Tn TA006130 17120..17704 0.003	flank	IS/Tn	-	-	23831..24415	584

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-85)

Antitoxin

No domain identified.

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 11197.09 Da
• Isoelectric Point: 10.6516

>T255056 WP_011078058.1 NZ_CP103446:c19790-19503 [Erwinia pyrifoliae]
MTYKLKFVPSAEKEWKRLGHPVREQFKKKLAERLENPRVPSAQLHGRKDQYKIKLKSAGYRLVYLVQEHTITIMVMGIGK
REGNQIYSDTENRLP

Nucleotide

• Length: 288 bp

Antitoxin

Protein

• Length: 85 a.a.
• Molecular weight: 9210.56 Da
• Isoelectric Point: 3.8705

>AT255056 WP_011078059.1 NZ_CP103446:c20034-19780 [Erwinia pyrifoliae]
MAFNILTNTAASITDLKRDPMGTVRAAEGETIAILNRNEPAFYCVPPAMYAYLMELAEDAELGCIVDDRMSELPVAKEIS
LDDL

Nucleotide

• Length: 255 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: E3DL65

Antitoxin

Loading, please wait

• AlphaFold DB: Q7X3U3