Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-orzP/SymE(toxin) |
Location | 4457958..4458370 | Replicon | chromosome |
Accession | NZ_CP102379 | ||
Organism | Escherichia coli strain BM28 lysU |
Toxin (Protein)
Gene name | symE | Uniprot ID | U9YSY7 |
Locus tag | NR350_RS21605 | Protein ID | WP_000132601.1 |
Coordinates | 4457958..4458299 (-) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | orzP | ||
Locus tag | - | ||
Coordinates | 4458294..4458370 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR350_RS21590 (4454033) | 4454033..4455079 | - | 1047 | WP_000437621.1 | 5-methylcytosine-specific restriction endonuclease system specificity protein McrC | - |
NR350_RS21595 (4455079) | 4455079..4456458 | - | 1380 | WP_000443951.1 | 5-methylcytosine-specific restriction endonuclease subunit McrB | - |
NR350_RS21600 (4456593) | 4456593..4457801 | + | 1209 | WP_001339197.1 | IS4-like element ISVsa5 family transposase | - |
NR350_RS21605 (4457958) | 4457958..4458299 | - | 342 | WP_000132601.1 | endoribonuclease SymE | Toxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_13 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_13 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_13 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_13 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_14 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_14 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_14 | - | Antitoxin |
- (4458294) | 4458294..4458370 | + | 77 | NuclAT_14 | - | Antitoxin |
NR350_RS21610 (4458527) | 4458527..4459921 | - | 1395 | WP_001272447.1 | type I restriction-modification system specificity subunit | - |
NR350_RS21615 (4459918) | 4459918..4461507 | - | 1590 | WP_001063204.1 | type I restriction-modification system methyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | - | 4449535..4459921 | 10386 | ||
- | flank | IS/Tn | - | - | 4456593..4457801 | 1208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12203.02 Da Isoelectric Point: 8.5012
>T253558 WP_000132601.1 NZ_CP102379:c4458299-4457958 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESE
LMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT253558 NZ_CP102379:4458294-4458370 [Escherichia coli]
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCTCCAGGAATAGTGATTGTGATTAGCGATGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|