Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 170790..171361 | Replicon | chromosome |
Accession | NZ_CP101984 | ||
Organism | Streptococcus mutans strain UA-159 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | Q8DW95 |
Locus tag | NPS18_RS00865 | Protein ID | WP_002262989.1 |
Coordinates | 171029..171361 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | Q8DW96 |
Locus tag | NPS18_RS00860 | Protein ID | WP_002262990.1 |
Coordinates | 170790..171035 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS18_RS00825 (NPS18_00825) | 166298..167044 | + | 747 | WP_002262998.1 | 23S rRNA (guanosine(2251)-2'-O)-methyltransferase RlmB | - |
NPS18_RS00830 (NPS18_00830) | 167068..167928 | + | 861 | WP_002262997.1 | DegV family protein | - |
NPS18_RS00835 (NPS18_00835) | 168060..168575 | + | 516 | WP_002262996.1 | hypothetical protein | - |
NPS18_RS00840 (NPS18_00840) | 168575..169021 | + | 447 | WP_002262995.1 | hypothetical protein | - |
NPS18_RS00845 (NPS18_00845) | 169018..169212 | + | 195 | WP_002262994.1 | helix-turn-helix transcriptional regulator | - |
NPS18_RS00850 (NPS18_00850) | 169605..170051 | + | 447 | WP_002262993.1 | 50S ribosomal protein L13 | - |
NPS18_RS00855 (NPS18_00855) | 170076..170468 | + | 393 | WP_002262992.1 | 30S ribosomal protein S9 | - |
NPS18_RS00860 (NPS18_00860) | 170790..171035 | + | 246 | WP_002262990.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NPS18_RS00865 (NPS18_00865) | 171029..171361 | + | 333 | WP_002262989.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NPS18_RS00870 (NPS18_00870) | 171559..172350 | - | 792 | WP_002262988.1 | nucleotidyltransferase domain-containing protein | - |
NPS18_RS00875 (NPS18_00875) | 172517..172870 | + | 354 | Protein_151 | transposase family protein | - |
NPS18_RS00880 (NPS18_00880) | 173052..174272 | + | 1221 | WP_002262024.1 | PTS sugar transporter subunit IIC | - |
NPS18_RS00885 (NPS18_00885) | 174250..175098 | + | 849 | WP_002262025.1 | alpha/beta hydrolase | - |
NPS18_RS00890 (NPS18_00890) | 175240..175842 | + | 603 | WP_002262026.1 | NADPH-dependent FMN reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 172517..172645 | 128 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12640.50 Da Isoelectric Point: 6.4634
>T253059 WP_002262989.1 NZ_CP101984:171029-171361 [Streptococcus mutans]
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIGIFAPISNTKRDYPFYVSLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
MVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIGIFAPISNTKRDYPFYVSLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|