Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4145605..4146419 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A7U1KVS1 |
Locus tag | NP448_RS20375 | Protein ID | WP_058653211.1 |
Coordinates | 4145605..4146132 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NP448_RS20380 | Protein ID | WP_000855694.1 |
Coordinates | 4146129..4146419 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS20345 (4141807) | 4141807..4142205 | + | 399 | Protein_3962 | cytoplasmic protein | - |
NP448_RS20350 (4142396) | 4142396..4142635 | + | 240 | Protein_3963 | hypothetical protein | - |
NP448_RS20355 (4142792) | 4142792..4143460 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NP448_RS20360 (4143487) | 4143487..4143981 | + | 495 | WP_000424947.1 | hypothetical protein | - |
NP448_RS20365 (4144226) | 4144226..4144882 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NP448_RS20370 (4145112) | 4145112..4145532 | + | 421 | Protein_3967 | IS5 family transposase | - |
NP448_RS20375 (4145605) | 4145605..4146132 | - | 528 | WP_058653211.1 | GNAT family N-acetyltransferase | Toxin |
NP448_RS20380 (4146129) | 4146129..4146419 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NP448_RS20385 (4146689) | 4146689..4146867 | - | 179 | Protein_3970 | IS3 family transposase | - |
NP448_RS20390 (4147108) | 4147108..4147434 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NP448_RS20395 (4147707) | 4147707..4148054 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NP448_RS20400 (4148039) | 4148039..4148488 | - | 450 | WP_000381617.1 | hypothetical protein | - |
NP448_RS20405 (4148920) | 4148920..4149363 | - | 444 | WP_001522905.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NP448_RS20410 (4149819) | 4149819..4150469 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 4145338..4155782 | 10444 | ||
- | flank | IS/Tn | - | - | 4145338..4145532 | 194 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T253054 WP_058653211.1 NZ_CP101940:c4146132-4145605 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KVS1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |