Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 4111456..4112270 | Replicon | chromosome |
Accession | NZ_CP101907 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 973 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A7U1KVS1 |
Locus tag | NP441_RS20160 | Protein ID | WP_058653211.1 |
Coordinates | 4111456..4111983 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | NP441_RS20165 | Protein ID | WP_000855694.1 |
Coordinates | 4111980..4112270 (-) | Length | 97 a.a. |
Genomic Context
Location: 4107658..4108056 (399 bp)
Type: Others
Protein ID: Protein_3919
Type: Others
Protein ID: Protein_3919
Location: 4108247..4108486 (240 bp)
Type: Others
Protein ID: Protein_3920
Type: Others
Protein ID: Protein_3920
Location: 4108643..4109311 (669 bp)
Type: Others
Protein ID: WP_000445914.1
Type: Others
Protein ID: WP_000445914.1
Location: 4109338..4109832 (495 bp)
Type: Others
Protein ID: WP_000424947.1
Type: Others
Protein ID: WP_000424947.1
Location: 4110963..4111383 (421 bp)
Type: Others
Protein ID: Protein_3924
Type: Others
Protein ID: Protein_3924
Location: 4112959..4113285 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 4115670..4116320 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 4110077..4110733 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 4111456..4111983 (528 bp)
Type: Toxin
Protein ID: WP_058653211.1
Type: Toxin
Protein ID: WP_058653211.1
Location: 4111980..4112270 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1
Type: Antitoxin
Protein ID: WP_000855694.1
Location: 4112540..4112718 (179 bp)
Type: Others
Protein ID: Protein_3927
Type: Others
Protein ID: Protein_3927
Location: 4113558..4113905 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 4113890..4114339 (450 bp)
Type: Others
Protein ID: WP_000381617.1
Type: Others
Protein ID: WP_000381617.1
Location: 4114771..4115214 (444 bp)
Type: Others
Protein ID: WP_001522905.1
Type: Others
Protein ID: WP_001522905.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP441_RS20130 (4107658) | 4107658..4108056 | + | 399 | Protein_3919 | cytoplasmic protein | - |
NP441_RS20135 (4108247) | 4108247..4108486 | + | 240 | Protein_3920 | hypothetical protein | - |
NP441_RS20140 (4108643) | 4108643..4109311 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NP441_RS20145 (4109338) | 4109338..4109832 | + | 495 | WP_000424947.1 | hypothetical protein | - |
NP441_RS20150 (4110077) | 4110077..4110733 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NP441_RS20155 (4110963) | 4110963..4111383 | + | 421 | Protein_3924 | IS5 family transposase | - |
NP441_RS20160 (4111456) | 4111456..4111983 | - | 528 | WP_058653211.1 | GNAT family N-acetyltransferase | Toxin |
NP441_RS20165 (4111980) | 4111980..4112270 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
NP441_RS20170 (4112540) | 4112540..4112718 | - | 179 | Protein_3927 | IS3 family transposase | - |
NP441_RS20175 (4112959) | 4112959..4113285 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NP441_RS20180 (4113558) | 4113558..4113905 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NP441_RS20185 (4113890) | 4113890..4114339 | - | 450 | WP_000381617.1 | hypothetical protein | - |
NP441_RS20190 (4114771) | 4114771..4115214 | - | 444 | WP_001522905.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NP441_RS20195 (4115670) | 4115670..4116320 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 4111189..4121633 | 10444 | ||
- | flank | IS/Tn | - | - | 4111189..4111383 | 194 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19051.87 Da Isoelectric Point: 9.6420
>T252877 WP_058653211.1 NZ_CP101907:c4111983-4111456 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KVS1 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |