Detailed information of TA system TA252877

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): tacAT/DUF1778(antitoxin)
• Location: 4111456..4112270
• Replicon: chromosome
• Accession: NZ_CP101907
• Organism: Salmonella enterica subsp. enterica strain QA-1986 973

Toxin (Protein)

• Gene name: TacT3
• Uniprot ID: A0A7U1KVS1
• Locus tag: NP441_RS20160
• Protein ID: WP_058653211.1
• Coordinates: 4111456..4111983 (-)
• Length: 176 a.a.

Antitoxin (Protein)

• Gene name: TacA3
• Uniprot ID: M7S6I2
• Locus tag: NP441_RS20165
• Protein ID: WP_000855694.1
• Coordinates: 4111980..4112270 (-)
• Length: 97 a.a.

Genomic Context

Location: 4107658..4108056 (399 bp)
Type: Others
Protein ID: Protein_3919

Location: 4108247..4108486 (240 bp)
Type: Others
Protein ID: Protein_3920

Location: 4108643..4109311 (669 bp)
Type: Others
Protein ID: WP_000445914.1

Location: 4109338..4109832 (495 bp)
Type: Others
Protein ID: WP_000424947.1

Location: 4110963..4111383 (421 bp)
Type: Others
Protein ID: Protein_3924

Location: 4112959..4113285 (327 bp)
Type: Others
Protein ID: WP_000393302.1

Location: 4115670..4116320 (651 bp)
Type: Others
Protein ID: WP_001674874.1

Location: 4110077..4110733 (657 bp)
Type: Others
Protein ID: WP_000420452.1

Location: 4111456..4111983 (528 bp)
Type: Toxin
Protein ID: WP_058653211.1

Location: 4111980..4112270 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1

Location: 4112540..4112718 (179 bp)
Type: Others
Protein ID: Protein_3927

Location: 4113558..4113905 (348 bp)
Type: Others
Protein ID: WP_001669174.1

Location: 4113890..4114339 (450 bp)
Type: Others
Protein ID: WP_000381617.1

Location: 4114771..4115214 (444 bp)
Type: Others
Protein ID: WP_001522905.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
NP441_RS20130 (4107658)	4107658..4108056	+	399	Protein_3919	cytoplasmic protein	-
NP441_RS20135 (4108247)	4108247..4108486	+	240	Protein_3920	hypothetical protein	-
NP441_RS20140 (4108643)	4108643..4109311	+	669	WP_000445914.1	hypothetical protein	-
NP441_RS20145 (4109338)	4109338..4109832	+	495	WP_000424947.1	hypothetical protein	-
NP441_RS20150 (4110077)	4110077..4110733	-	657	WP_000420452.1	protein-serine/threonine phosphatase	-
NP441_RS20155 (4110963)	4110963..4111383	+	421	Protein_3924	IS5 family transposase	-
NP441_RS20160 (4111456)	4111456..4111983	-	528	WP_058653211.1	GNAT family N-acetyltransferase	Toxin
NP441_RS20165 (4111980)	4111980..4112270	-	291	WP_000855694.1	DUF1778 domain-containing protein	Antitoxin
NP441_RS20170 (4112540)	4112540..4112718	-	179	Protein_3927	IS3 family transposase	-
NP441_RS20175 (4112959)	4112959..4113285	+	327	WP_000393302.1	hypothetical protein	-
NP441_RS20180 (4113558)	4113558..4113905	-	348	WP_001669174.1	DUF1493 family protein	-
NP441_RS20185 (4113890)	4113890..4114339	-	450	WP_000381617.1	hypothetical protein	-
NP441_RS20190 (4114771)	4114771..4115214	-	444	WP_001522905.1	SPI-1 type III secretion system invasion lipoprotein InvH	-
NP441_RS20195 (4115670)	4115670..4116320	+	651	WP_001674874.1	type III secretion system transcriptional activator InvF	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View UFRD01000002 Salmonella enterica subsp. enterica serovar Typhimurium strain NCTC12023 Genomic island TA010052 4599654..4610080 0.006	inside	Genomic island	-	invH / invF / invG / invE / invA / invB	4111189..4121633	10444
	-	flank	IS/Tn	-	-	4111189..4111383	194

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Antitoxin

• Vibrio phage ICP1, Orf50 (1-95)

Sequences

Toxin

Protein

• Length: 176 a.a.
• Molecular weight: 19051.87 Da
• Isoelectric Point: 9.6420

>T252877 WP_058653211.1 NZ_CP101907:c4111983-4111456 [Salmonella enterica subsp. enterica]
MMFTDWHEAAIGKTHNRINFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL

Nucleotide

• Length: 528 bp

Antitoxin

Protein

• Length: 97 a.a.
• Molecular weight: 10664.50 Da
• Isoelectric Point: 6.3133

>AT252877 WP_000855694.1 NZ_CP101907:c4112270-4111980 [Salmonella enterica subsp. enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK

Nucleotide

• Length: 291 bp

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: A0A7U1KVS1

Antitoxin

Loading, please wait

• AlphaFold DB: A0A3V8SJE7