Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | IasE-IsrA/- |
Location | 3612835..3613237 | Replicon | chromosome |
Accession | NZ_CP101689 | ||
Organism | Salmonella enterica subsp. enterica serovar Mbandaka strain SMEH |
Toxin (Protein)
Gene name | IasE | Uniprot ID | A0A418Z3G0 |
Locus tag | NOV91_RS17510 | Protein ID | WP_017442176.1 |
Coordinates | 3612835..3613080 (-) | Length | 82 a.a. |
Antitoxin (RNA)
Gene name | IsrA | ||
Locus tag | - | ||
Coordinates | 3612930..3613237 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NOV91_RS17460 | 3608543..3609025 | + | 483 | WP_017442170.1 | immunity 26/phosphotriesterase HocA family protein | - |
NOV91_RS17465 | 3609078..3609305 | - | 228 | WP_017442171.1 | SymE family type I addiction module toxin | - |
NOV91_RS17470 | 3609488..3609604 | + | 117 | Protein_3400 | RHS repeat-associated core domain-containing protein | - |
NOV91_RS17475 | 3609719..3610000 | + | 282 | WP_176132412.1 | hypothetical protein | - |
NOV91_RS17480 | 3609997..3610443 | + | 447 | WP_017442172.1 | hypothetical protein | - |
NOV91_RS17485 | 3610802..3610954 | + | 153 | WP_223195354.1 | hypothetical protein | - |
NOV91_RS17490 | 3610975..3611253 | + | 279 | WP_197398372.1 | hypothetical protein | - |
NOV91_RS17495 | 3611255..3611833 | + | 579 | WP_017442174.1 | hypothetical protein | - |
NOV91_RS17500 | 3612038..3612415 | + | 378 | WP_223195355.1 | HNH endonuclease | - |
NOV91_RS17505 | 3612412..3612768 | + | 357 | WP_017442175.1 | hypothetical protein | - |
NOV91_RS17510 | 3612835..3613080 | - | 246 | WP_017442176.1 | hypothetical protein | Toxin |
- | 3612930..3613237 | + | 308 | - | - | Antitoxin |
NOV91_RS17515 | 3613414..3613707 | + | 294 | WP_129369132.1 | hypothetical protein | - |
NOV91_RS17520 | 3614157..3614528 | + | 372 | WP_223195353.1 | hypothetical protein | - |
NOV91_RS17525 | 3614525..3614992 | + | 468 | WP_017442178.1 | hypothetical protein | - |
NOV91_RS17530 | 3615310..3615588 | + | 279 | WP_077907264.1 | hypothetical protein | - |
NOV91_RS17535 | 3615655..3615969 | - | 315 | WP_072103451.1 | SymE family type I addiction module toxin | - |
NOV91_RS17540 | 3616022..3616180 | + | 159 | Protein_3414 | transposase | - |
NOV91_RS17545 | 3616248..3616805 | - | 558 | Protein_3415 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3583204..3626822 | 43618 | |
- | flank | IS/Tn | - | - | 3616248..3616625 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 82 a.a. Molecular weight: 8761.95 Da Isoelectric Point: 4.3010
>T252503 WP_017442176.1 NZ_CP101689:c3613080-3612835 [Salmonella enterica subsp. enterica serovar Mbandaka]
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
MNASGASVRHINSETCMTACYSQIPSGDCQEEAGFETGRSVTVKISDGCIVLMADGNEVQKLCEQLYKAEQVVKGMWDVI
V
Download Length: 246 bp
Antitoxin
Download Length: 308 bp
>AT252503 NZ_CP101689:3612930-3613237 [Salmonella enterica subsp. enterica serovar Mbandaka]
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
CAATACACCCGTCCGAAATCTTCACCGTCACGCTGCGCCCGGTCTCAAATCCCGCTTCTTCCTGGCAGTCGCCGCTGGGG
ATTTGTGAGTAACAGGCGGTCATGCAGGTTTCGCTGTTGATGTGGCGGACGCTGGCGCCGGAGGCATTCATATTTGCTGA
CTAAATAAATTCTTAATTCTCCGCCGGATGCTGGCTGATTGTGGAGCTCAGGGTGAGCGAGTATGGGCGCGACATCATGG
CACCGCGCCTCCCTCTCCCCGGCCAGCACCGGGCGGTGATGAGCAACCGGCTGCCGGGGCCGTATTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|