Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1012468..1013282 | Replicon | chromosome |
Accession | NZ_CP100744 | ||
Organism | Salmonella enterica subsp. enterica serovar Newport strain R18.0234 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | Q57KM2 |
Locus tag | FGU68_RS04870 | Protein ID | WP_000971655.1 |
Coordinates | 1012468..1012995 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | FGU68_RS04875 | Protein ID | WP_000855694.1 |
Coordinates | 1012992..1013282 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FGU68_RS04840 (1008750) | 1008750..1009148 | + | 399 | Protein_948 | cytoplasmic protein | - |
FGU68_RS04845 (1009339) | 1009339..1009578 | + | 240 | Protein_949 | hypothetical protein | - |
FGU68_RS04850 (1009735) | 1009735..1010403 | + | 669 | WP_000445914.1 | hypothetical protein | - |
FGU68_RS04855 (1010430) | 1010430..1010924 | + | 495 | WP_000424948.1 | hypothetical protein | - |
FGU68_RS04860 (1011096) | 1011096..1011752 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
FGU68_RS04865 (1011985) | 1011985..1012395 | + | 411 | Protein_953 | transposase | - |
FGU68_RS04870 (1012468) | 1012468..1012995 | - | 528 | WP_000971655.1 | GNAT family N-acetyltransferase | Toxin |
FGU68_RS04875 (1012992) | 1012992..1013282 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
FGU68_RS04880 (1013552) | 1013552..1013730 | - | 179 | Protein_956 | IS3 family transposase | - |
FGU68_RS04885 (1013971) | 1013971..1014297 | + | 327 | WP_000393302.1 | hypothetical protein | - |
FGU68_RS04890 (1014570) | 1014570..1014917 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
FGU68_RS04895 (1014902) | 1014902..1015351 | - | 450 | WP_000381610.1 | membrane protein | - |
FGU68_RS04900 (1015783) | 1015783..1016226 | - | 444 | WP_000715099.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
FGU68_RS04905 (1016682) | 1016682..1017332 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1011096..1022645 | 11549 | ||
- | flank | IS/Tn | - | - | 1012171..1012395 | 224 | |
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 1012171..1022645 | 10474 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19069.91 Da Isoelectric Point: 9.6420
>T251325 WP_000971655.1 NZ_CP100744:c1012995-1012468 [Salmonella enterica subsp. enterica serovar Newport]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT251325 WP_000855694.1 NZ_CP100744:c1013282-1012992 [Salmonella enterica subsp. enterica serovar Newport]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 6G96 | |
PDB | 7AK9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |