Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1624017..1624696 | Replicon | chromosome |
| Accession | NZ_CP099856 | ||
| Organism | Acinetobacter baumannii strain 17978S | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | NIY04_RS07710 | Protein ID | WP_000838146.1 |
| Coordinates | 1624017..1624199 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | NIY04_RS07715 | Protein ID | WP_000966688.1 |
| Coordinates | 1624292..1624696 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY04_RS07675 (NIY04_07675) | 1619260..1619658 | + | 399 | WP_001251846.1 | phage tail terminator-like protein | - |
| NIY04_RS07680 (NIY04_07680) | 1619660..1619878 | + | 219 | WP_001277696.1 | hypothetical protein | - |
| NIY04_RS07685 (NIY04_07685) | 1619987..1620508 | + | 522 | WP_000749906.1 | SH3 domain-containing protein | - |
| NIY04_RS07690 (NIY04_07690) | 1620605..1620958 | + | 354 | WP_000064603.1 | hypothetical protein | - |
| NIY04_RS07695 (NIY04_07695) | 1620958..1622136 | + | 1179 | WP_000002414.1 | hypothetical protein | - |
| NIY04_RS07700 (NIY04_07700) | 1622189..1623106 | + | 918 | WP_000094261.1 | phage tail tube protein | - |
| NIY04_RS07705 (NIY04_07705) | 1623176..1623691 | + | 516 | WP_001185604.1 | hypothetical protein | - |
| NIY04_RS07710 (NIY04_07710) | 1624017..1624199 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIY04_RS07715 (NIY04_07715) | 1624292..1624696 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIY04_RS07720 (NIY04_07720) | 1624796..1624972 | + | 177 | WP_074031683.1 | hypothetical protein | - |
| NIY04_RS07725 (NIY04_07725) | 1624981..1625304 | + | 324 | WP_000523932.1 | DUF4236 domain-containing protein | - |
| NIY04_RS07730 (NIY04_07730) | 1625338..1625727 | + | 390 | WP_031977960.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1583956..1639331 | 55375 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T249533 WP_000838146.1 NZ_CP099856:1624017-1624199 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT249533 WP_000966688.1 NZ_CP099856:1624292-1624696 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|