Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1624017..1624696 Replicon chromosome
Accession NZ_CP099856
Organism Acinetobacter baumannii strain 17978S

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag NIY04_RS07710 Protein ID WP_000838146.1
Coordinates 1624017..1624199 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag NIY04_RS07715 Protein ID WP_000966688.1
Coordinates 1624292..1624696 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY04_RS07675 (NIY04_07675) 1619260..1619658 + 399 WP_001251846.1 phage tail terminator-like protein -
NIY04_RS07680 (NIY04_07680) 1619660..1619878 + 219 WP_001277696.1 hypothetical protein -
NIY04_RS07685 (NIY04_07685) 1619987..1620508 + 522 WP_000749906.1 SH3 domain-containing protein -
NIY04_RS07690 (NIY04_07690) 1620605..1620958 + 354 WP_000064603.1 hypothetical protein -
NIY04_RS07695 (NIY04_07695) 1620958..1622136 + 1179 WP_000002414.1 hypothetical protein -
NIY04_RS07700 (NIY04_07700) 1622189..1623106 + 918 WP_000094261.1 phage tail tube protein -
NIY04_RS07705 (NIY04_07705) 1623176..1623691 + 516 WP_001185604.1 hypothetical protein -
NIY04_RS07710 (NIY04_07710) 1624017..1624199 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
NIY04_RS07715 (NIY04_07715) 1624292..1624696 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIY04_RS07720 (NIY04_07720) 1624796..1624972 + 177 WP_074031683.1 hypothetical protein -
NIY04_RS07725 (NIY04_07725) 1624981..1625304 + 324 WP_000523932.1 DUF4236 domain-containing protein -
NIY04_RS07730 (NIY04_07730) 1625338..1625727 + 390 WP_031977960.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1583956..1639331 55375


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T249533 WP_000838146.1 NZ_CP099856:1624017-1624199 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT249533 WP_000966688.1 NZ_CP099856:1624292-1624696 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References