Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1613681..1614360 | Replicon | chromosome |
| Accession | NZ_CP099855 | ||
| Organism | Acinetobacter baumannii strain 17978R | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S3TWT7 |
| Locus tag | NIY03_RS07640 | Protein ID | WP_000838146.1 |
| Coordinates | 1613681..1613863 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | N9L2H6 |
| Locus tag | NIY03_RS07645 | Protein ID | WP_000966688.1 |
| Coordinates | 1613956..1614360 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NIY03_RS07605 (NIY03_07605) | 1608924..1609322 | + | 399 | WP_001251846.1 | phage tail terminator-like protein | - |
| NIY03_RS07610 (NIY03_07610) | 1609324..1609542 | + | 219 | WP_001277696.1 | hypothetical protein | - |
| NIY03_RS07615 (NIY03_07615) | 1609651..1610172 | + | 522 | WP_000749906.1 | SH3 domain-containing protein | - |
| NIY03_RS07620 (NIY03_07620) | 1610269..1610622 | + | 354 | WP_000064603.1 | hypothetical protein | - |
| NIY03_RS07625 (NIY03_07625) | 1610622..1611800 | + | 1179 | WP_000002414.1 | hypothetical protein | - |
| NIY03_RS07630 (NIY03_07630) | 1611853..1612770 | + | 918 | WP_000094261.1 | phage tail tube protein | - |
| NIY03_RS07635 (NIY03_07635) | 1612840..1613355 | + | 516 | WP_001185604.1 | hypothetical protein | - |
| NIY03_RS07640 (NIY03_07640) | 1613681..1613863 | + | 183 | WP_000838146.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NIY03_RS07645 (NIY03_07645) | 1613956..1614360 | + | 405 | WP_000966688.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NIY03_RS07650 (NIY03_07650) | 1614460..1614636 | + | 177 | WP_074031683.1 | hypothetical protein | - |
| NIY03_RS07655 (NIY03_07655) | 1614645..1614968 | + | 324 | WP_000523932.1 | DUF4236 domain-containing protein | - |
| NIY03_RS07660 (NIY03_07660) | 1615002..1615391 | + | 390 | WP_031977960.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1573612..1628995 | 55383 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6695.84 Da Isoelectric Point: 10.5523
>T249530 WP_000838146.1 NZ_CP099855:1613681-1613863 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14647.69 Da Isoelectric Point: 4.4328
>AT249530 WP_000966688.1 NZ_CP099855:1613956-1614360 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|