Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1613681..1614360 Replicon chromosome
Accession NZ_CP099855
Organism Acinetobacter baumannii strain 17978R

Toxin (Protein)


Gene name hicA Uniprot ID S3TWT7
Locus tag NIY03_RS07640 Protein ID WP_000838146.1
Coordinates 1613681..1613863 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID N9L2H6
Locus tag NIY03_RS07645 Protein ID WP_000966688.1
Coordinates 1613956..1614360 (+) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NIY03_RS07605 (NIY03_07605) 1608924..1609322 + 399 WP_001251846.1 phage tail terminator-like protein -
NIY03_RS07610 (NIY03_07610) 1609324..1609542 + 219 WP_001277696.1 hypothetical protein -
NIY03_RS07615 (NIY03_07615) 1609651..1610172 + 522 WP_000749906.1 SH3 domain-containing protein -
NIY03_RS07620 (NIY03_07620) 1610269..1610622 + 354 WP_000064603.1 hypothetical protein -
NIY03_RS07625 (NIY03_07625) 1610622..1611800 + 1179 WP_000002414.1 hypothetical protein -
NIY03_RS07630 (NIY03_07630) 1611853..1612770 + 918 WP_000094261.1 phage tail tube protein -
NIY03_RS07635 (NIY03_07635) 1612840..1613355 + 516 WP_001185604.1 hypothetical protein -
NIY03_RS07640 (NIY03_07640) 1613681..1613863 + 183 WP_000838146.1 type II toxin-antitoxin system HicA family toxin Toxin
NIY03_RS07645 (NIY03_07645) 1613956..1614360 + 405 WP_000966688.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NIY03_RS07650 (NIY03_07650) 1614460..1614636 + 177 WP_074031683.1 hypothetical protein -
NIY03_RS07655 (NIY03_07655) 1614645..1614968 + 324 WP_000523932.1 DUF4236 domain-containing protein -
NIY03_RS07660 (NIY03_07660) 1615002..1615391 + 390 WP_031977960.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 1573612..1628995 55383


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6695.84 Da        Isoelectric Point: 10.5523

>T249530 WP_000838146.1 NZ_CP099855:1613681-1613863 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14647.69 Da        Isoelectric Point: 4.4328

>AT249530 WP_000966688.1 NZ_CP099855:1613956-1614360 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S3TWT7

Antitoxin

Source ID Structure
AlphaFold DB N9L2H6

References