Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 979600..980414 | Replicon | chromosome |
Accession | NZ_CP098831 | ||
Organism | Salmonella enterica subsp. enterica serovar Indiana strain YZ20MCS14 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | A0A4Y6MAM1 |
Locus tag | NFH10_RS04675 | Protein ID | WP_023227563.1 |
Coordinates | 979600..980127 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | A0A4Y6M833 |
Locus tag | NFH10_RS04680 | Protein ID | WP_072162154.1 |
Coordinates | 980124..980414 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NFH10_RS04650 (975901) | 975901..976299 | + | 399 | Protein_912 | cytoplasmic protein | - |
NFH10_RS04655 (976885) | 976885..977553 | + | 669 | WP_000445914.1 | hypothetical protein | - |
NFH10_RS04660 (977580) | 977580..978074 | + | 495 | WP_023227564.1 | hypothetical protein | - |
NFH10_RS04665 (978319) | 978319..978975 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
NFH10_RS04670 (979310) | 979310..979527 | + | 218 | Protein_916 | IS5/IS1182 family transposase | - |
NFH10_RS04675 (979600) | 979600..980127 | - | 528 | WP_023227563.1 | GNAT family N-acetyltransferase | Toxin |
NFH10_RS04680 (980124) | 980124..980414 | - | 291 | WP_072162154.1 | DUF1778 domain-containing protein | Antitoxin |
NFH10_RS04685 (980684) | 980684..980862 | - | 179 | Protein_919 | IS3 family transposase | - |
NFH10_RS04690 (981103) | 981103..981429 | + | 327 | WP_000393302.1 | hypothetical protein | - |
NFH10_RS04695 (981702) | 981702..982049 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
NFH10_RS04700 (982034) | 982034..982483 | - | 450 | WP_000381610.1 | membrane protein | - |
NFH10_RS04705 (982914) | 982914..983357 | - | 444 | WP_000715096.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
NFH10_RS04710 (983813) | 983813..984463 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 979387..989776 | 10389 | ||
- | flank | IS/Tn | - | - | 979387..979527 | 140 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19099.93 Da Isoelectric Point: 9.6420
>T248132 WP_023227563.1 NZ_CP098831:c980127-979600 [Salmonella enterica subsp. enterica serovar Indiana]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGSVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGSVALLIDAKNKQVCDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.54 Da Isoelectric Point: 8.5779
>AT248132 WP_072162154.1 NZ_CP098831:c980414-980124 [Salmonella enterica subsp. enterica serovar Indiana]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTKMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6MAM1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4Y6M833 |