Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3212454..3212980 | Replicon | chromosome |
Accession | NZ_CP097840 | ||
Organism | Shigella flexneri strain A |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | M9382_RS15885 | Protein ID | WP_000323025.1 |
Coordinates | 3212454..3212741 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | M9382_RS15890 | Protein ID | WP_000534858.1 |
Coordinates | 3212741..3212980 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9382_RS15835 (3207512) | 3207512..3207847 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
M9382_RS15840 (3208128) | 3208128..3208236 | - | 109 | Protein_3079 | DUF3927 family protein | - |
M9382_RS15855 (3209157) | 3209157..3209978 | - | 822 | WP_000762884.1 | antitermination protein | - |
M9382_RS15860 (3209993) | 3209993..3210349 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
M9382_RS15865 (3210362) | 3210362..3211411 | - | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
M9382_RS15870 (3211413) | 3211413..3211691 | - | 279 | Protein_3083 | hypothetical protein | - |
M9382_RS15875 (3211794) | 3211794..3212009 | - | 216 | WP_000980986.1 | hypothetical protein | - |
M9382_RS15880 (3212227) | 3212227..3212382 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
M9382_RS15885 (3212454) | 3212454..3212741 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
M9382_RS15890 (3212741) | 3212741..3212980 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
M9382_RS15895 (3213005) | 3213005..3213310 | + | 306 | WP_071818640.1 | hypothetical protein | - |
M9382_RS15900 (3213307) | 3213307..3214185 | - | 879 | Protein_3089 | IS3-like element IS600 family transposase | - |
M9382_RS15910 (3214957) | 3214957..3215385 | + | 429 | Protein_3091 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 3204315..3217998 | 13683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246369 WP_000323025.1 NZ_CP097840:c3212741-3212454 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|