Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2080846..2081372 | Replicon | chromosome |
Accession | NZ_CP097837 | ||
Organism | Shigella flexneri strain B |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | M9380_RS10535 | Protein ID | WP_000323025.1 |
Coordinates | 2081085..2081372 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | M9380_RS10530 | Protein ID | WP_000534858.1 |
Coordinates | 2080846..2081085 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9380_RS10510 (2078441) | 2078441..2078869 | - | 429 | Protein_2040 | fimbrial protein | - |
M9380_RS10515 (2078926) | 2078926..2079623 | + | 698 | WP_232046037.1 | IS1 family transposase | - |
M9380_RS10520 (2079641) | 2079641..2080519 | + | 879 | Protein_2042 | IS3-like element IS600 family transposase | - |
M9380_RS10525 (2080516) | 2080516..2080821 | - | 306 | WP_071818640.1 | hypothetical protein | - |
M9380_RS10530 (2080846) | 2080846..2081085 | + | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
M9380_RS10535 (2081085) | 2081085..2081372 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
M9380_RS10540 (2081444) | 2081444..2081599 | + | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
M9380_RS10545 (2081817) | 2081817..2082032 | + | 216 | WP_000980986.1 | hypothetical protein | - |
M9380_RS10550 (2082135) | 2082135..2082413 | + | 279 | Protein_2048 | hypothetical protein | - |
M9380_RS10555 (2082415) | 2082415..2083464 | + | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
M9380_RS10560 (2083477) | 2083477..2083833 | + | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
M9380_RS10565 (2083848) | 2083848..2084669 | + | 822 | WP_000762884.1 | antitermination protein | - |
M9380_RS10580 (2085590) | 2085590..2085698 | + | 109 | Protein_2052 | DUF3927 family protein | - |
M9380_RS10585 (2085979) | 2085979..2086314 | - | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2075828..2089511 | 13683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246345 WP_000323025.1 NZ_CP097837:2081085-2081372 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|