Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 1169247..1169773 | Replicon | chromosome |
| Accession | NZ_CP097834 | ||
| Organism | Shigella flexneri strain C | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M9379_RS05955 | Protein ID | WP_000323025.1 |
| Coordinates | 1169247..1169534 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M9379_RS05960 | Protein ID | WP_000534858.1 |
| Coordinates | 1169534..1169773 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9379_RS05905 (1164305) | 1164305..1164640 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| M9379_RS05910 (1164921) | 1164921..1165029 | - | 109 | Protein_1151 | DUF3927 family protein | - |
| M9379_RS05925 (1165950) | 1165950..1166771 | - | 822 | WP_000762884.1 | antitermination protein | - |
| M9379_RS05930 (1166786) | 1166786..1167142 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9379_RS05935 (1167155) | 1167155..1168204 | - | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| M9379_RS05940 (1168206) | 1168206..1168484 | - | 279 | Protein_1155 | hypothetical protein | - |
| M9379_RS05945 (1168587) | 1168587..1168802 | - | 216 | WP_000980986.1 | hypothetical protein | - |
| M9379_RS05950 (1169020) | 1169020..1169175 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| M9379_RS05955 (1169247) | 1169247..1169534 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M9379_RS05960 (1169534) | 1169534..1169773 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M9379_RS05965 (1169798) | 1169798..1170103 | + | 306 | WP_071818640.1 | hypothetical protein | - |
| M9379_RS05970 (1170100) | 1170100..1170978 | - | 879 | Protein_1161 | IS3-like element IS600 family transposase | - |
| M9379_RS05980 (1171750) | 1171750..1172178 | + | 429 | Protein_1163 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 1161108..1174791 | 13683 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246324 WP_000323025.1 NZ_CP097834:c1169534-1169247 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|