Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 3213278..3213804 | Replicon | chromosome |
| Accession | NZ_CP097831 | ||
| Organism | Shigella flexneri strain D | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M9381_RS15900 | Protein ID | WP_000323025.1 |
| Coordinates | 3213278..3213565 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | S1F6D3 |
| Locus tag | M9381_RS15905 | Protein ID | WP_000534858.1 |
| Coordinates | 3213565..3213804 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M9381_RS15850 (3208336) | 3208336..3208671 | + | 336 | WP_000871291.1 | anti-adapter protein IraM | - |
| M9381_RS15855 (3208952) | 3208952..3209060 | - | 109 | Protein_3082 | DUF3927 family protein | - |
| M9381_RS15870 (3209981) | 3209981..3210802 | - | 822 | WP_000762884.1 | antitermination protein | - |
| M9381_RS15875 (3210817) | 3210817..3211173 | - | 357 | WP_000904111.1 | RusA family crossover junction endodeoxyribonuclease | - |
| M9381_RS15880 (3211186) | 3211186..3212235 | - | 1050 | WP_001265249.1 | DUF968 domain-containing protein | - |
| M9381_RS15885 (3212237) | 3212237..3212515 | - | 279 | Protein_3086 | hypothetical protein | - |
| M9381_RS15890 (3212618) | 3212618..3212833 | - | 216 | WP_000980986.1 | hypothetical protein | - |
| M9381_RS15895 (3213051) | 3213051..3213206 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
| M9381_RS15900 (3213278) | 3213278..3213565 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M9381_RS15905 (3213565) | 3213565..3213804 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M9381_RS15910 (3213829) | 3213829..3214134 | + | 306 | WP_071818640.1 | hypothetical protein | - |
| M9381_RS15915 (3214131) | 3214131..3215009 | - | 879 | Protein_3092 | IS3-like element IS600 family transposase | - |
| M9381_RS15925 (3215781) | 3215781..3216209 | + | 429 | Protein_3094 | fimbrial protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 3205139..3223934 | 18795 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T246308 WP_000323025.1 NZ_CP097831:c3213565-3213278 [Shigella flexneri]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|