Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
Location | 4394596..4395410 | Replicon | chromosome |
Accession | NZ_CP097716 | ||
Organism | Escherichia coli strain MS1718 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | S1PA82 |
Locus tag | M9O77_RS20945 | Protein ID | WP_001054376.1 |
Coordinates | 4394596..4394853 (+) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | U9Z4B8 |
Locus tag | M9O77_RS20950 | Protein ID | WP_001309181.1 |
Coordinates | 4394865..4395410 (+) | Length | 182 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M9O77_RS20920 (4389856) | 4389856..4390836 | + | 981 | WP_000991438.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
M9O77_RS20925 (4390946) | 4390946..4391151 | + | 206 | Protein_4100 | HNH endonuclease | - |
M9O77_RS20930 (4391451) | 4391451..4392431 | - | 981 | WP_000019400.1 | IS5-like element IS5 family transposase | - |
M9O77_RS20935 (4392618) | 4392618..4393858 | - | 1241 | Protein_4102 | helicase YjhR | - |
M9O77_RS20940 (4393974) | 4393974..4394105 | + | 132 | WP_001309182.1 | hypothetical protein | - |
M9O77_RS20945 (4394596) | 4394596..4394853 | + | 258 | WP_001054376.1 | YjhX family toxin | Toxin |
M9O77_RS20950 (4394865) | 4394865..4395410 | + | 546 | WP_001309181.1 | N-acetyltransferase | Antitoxin |
M9O77_RS20955 (4395466) | 4395466..4396212 | + | 747 | WP_000354251.1 | class I SAM-dependent methyltransferase | - |
M9O77_RS20960 (4396381) | 4396381..4396599 | + | 219 | Protein_4107 | hypothetical protein | - |
M9O77_RS20965 (4396637) | 4396637..4396753 | + | 117 | Protein_4108 | VOC family protein | - |
M9O77_RS20970 (4396998) | 4396998..4398119 | + | 1122 | WP_000010829.1 | M42 family metallopeptidase | - |
M9O77_RS20975 (4398116) | 4398116..4398394 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB SgcB | - |
M9O77_RS20980 (4398406) | 4398406..4399719 | + | 1314 | WP_000460843.1 | PTS sugar transporter subunit IIC SgcC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | fimB | 4385891..4395410 | 9519 | |
flank | IS/Tn | - | - | 4391451..4392431 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9734.29 Da Isoelectric Point: 11.0090
>T246106 WP_001054376.1 NZ_CP097716:4394596-4394853 [Escherichia coli]
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
MNLSRQEQHTLHVLAKGRRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTELNKVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 182 a.a. Molecular weight: 19956.90 Da Isoelectric Point: 6.3277
>AT246106 WP_001309181.1 NZ_CP097716:4394865-4395410 [Escherichia coli]
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
MTVHHFTFHITDKSDASDIREVETRAFGFSKEADLVASLLEDESARPALSLLARYEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQSLTA
QPMTLTGHIRCADPDETGALT
Download Length: 546 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|