Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1879139..1879319 | Replicon | chromosome |
Accession | NC_013450 | ||
Organism | Staphylococcus aureus subsp. aureus ED98 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAAV_RS15280 | Protein ID | WP_114579884.1 |
Coordinates | 1879139..1879234 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1879262..1879319 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAAV_RS09295 | 1874302..1874952 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SAAV_RS09300 | 1875033..1876028 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SAAV_RS09305 | 1876103..1876729 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SAAV_RS09310 | 1876770..1877111 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SAAV_RS09315 | 1877212..1877784 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SAAV_RS14935 | 1877982..1878994 | - | 1013 | Protein_1788 | IS3 family transposase | - |
SAAV_RS15280 | 1879139..1879234 | + | 96 | WP_114579884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1879262..1879319 | - | 58 | - | - | Antitoxin |
SAAV_RS09335 | 1879357..1879458 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAAV_RS15285 | 1879436..1879597 | - | 162 | Protein_1791 | transposase | - |
SAAV_RS09340 | 1879588..1880082 | - | 495 | Protein_1792 | transposase | - |
SAAV_RS09345 | 1880534..1881763 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
SAAV_RS09350 | 1881756..1883312 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
SAAV_RS09355 | 1883476..1883610 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1873544..1906152 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3570.36 Da Isoelectric Point: 10.4449
>T24411 WP_114579884.1 NC_013450:1879139-1879234 [Staphylococcus aureus subsp. aureus ED98]
VMLIFVHIIALVISGCAIAFFSYWLSRRNTK
VMLIFVHIIALVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T24411 NC_013450:1879139-1879234 [Staphylococcus aureus subsp. aureus ED98]
GTGATGCTTATTTTCGTTCACATCATAGCACTAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACTAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT24411 NC_013450:c1879319-1879262 [Staphylococcus aureus subsp. aureus ED98]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|