Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1742319..1742499 | Replicon | chromosome |
Accession | NZ_CP090873 | ||
Organism | Staphylococcus aureus strain SAUR_BFS16 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | L1A02_RS08840 | Protein ID | WP_001801861.1 |
Coordinates | 1742404..1742499 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1742319..1742376 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L1A02_RS08810 | 1738028..1738162 | + | 135 | WP_001791797.1 | hypothetical protein | - |
L1A02_RS08815 | 1738326..1739882 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
L1A02_RS08820 | 1739875..1741104 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
L1A02_RS08825 | 1741646..1742056 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
L1A02_RS08830 | 1742041..1742202 | + | 162 | Protein_1692 | transposase | - |
L1A02_RS08835 | 1742180..1742281 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 1742319..1742376 | + | 58 | - | - | Antitoxin |
L1A02_RS08840 | 1742404..1742499 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
L1A02_RS08845 | 1742644..1743656 | + | 1013 | Protein_1695 | IS3 family transposase | - |
L1A02_RS08850 | 1743854..1744426 | - | 573 | WP_000414216.1 | hypothetical protein | - |
L1A02_RS08855 | 1744527..1744868 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
L1A02_RS08860 | 1744909..1745535 | - | 627 | WP_000669024.1 | hypothetical protein | - |
L1A02_RS08865 | 1745610..1746605 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
L1A02_RS08870 | 1746686..1747336 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 1715486..1748094 | 32608 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T231986 WP_001801861.1 NZ_CP090873:c1742499-1742404 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T231986 NZ_CP127101:990110-990271 [Staphylococcus pseudintermedius]
ATGAAAGACGAACAAAAGCATTATGATAATGAAATGGTTGATAGTTTTGATGATGTTGTGGAGCTCGGTAAAGAAATGGA
ACAAATTTCTGAAGCGAACGATGAAGAGAAACTCAATCAAGCACATGATTCCAAAGTGCGTTCTGATAAAAATACAAAAT
AA
ATGAAAGACGAACAAAAGCATTATGATAATGAAATGGTTGATAGTTTTGATGATGTTGTGGAGCTCGGTAAAGAAATGGA
ACAAATTTCTGAAGCGAACGATGAAGAGAAACTCAATCAAGCACATGATTCCAAAGTGCGTTCTGATAAAAATACAAAAT
AA
Antitoxin
Download Length: 58 bp
>AT231986 NZ_CP090873:1742319-1742376 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|