Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 300233..300413 | Replicon | chromosome |
Accession | NZ_CP090870 | ||
Organism | Staphylococcus aureus strain SAUR_BFS62 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | L0999_RS01470 | Protein ID | WP_001801861.1 |
Coordinates | 300233..300328 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 300356..300413 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L0999_RS01440 | 295396..296046 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
L0999_RS01445 | 296127..297122 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
L0999_RS01450 | 297197..297823 | + | 627 | WP_000669024.1 | hypothetical protein | - |
L0999_RS01455 | 297864..298205 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
L0999_RS01460 | 298306..298878 | + | 573 | WP_000414216.1 | hypothetical protein | - |
L0999_RS01465 | 299076..300088 | - | 1013 | Protein_291 | IS3 family transposase | - |
L0999_RS01470 | 300233..300328 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 300356..300413 | - | 58 | - | - | Antitoxin |
L0999_RS01475 | 300451..300552 | + | 102 | WP_001792025.1 | hypothetical protein | - |
L0999_RS01480 | 300530..300691 | - | 162 | Protein_294 | transposase | - |
L0999_RS01485 | 300676..301086 | - | 411 | WP_001808705.1 | IS21 family transposase | - |
L0999_RS01490 | 301628..302857 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
L0999_RS01495 | 302850..304406 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
L0999_RS01500 | 304570..304704 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 294638..329916 | 35278 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T231957 WP_001801861.1 NZ_CP090870:300233-300328 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T231957 NZ_CP127024:c2059684-2059532 [Staphylococcus aureus]
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
ATGTCTAAAGACAAAGATCCAAAATTAAATTATCATGAAGAAGAAAACAGTATGGTAACGGATTTTGAAGATTTAAAAGA
ATTAGGTAAAGAAATGGAACAAATCTCTGATCAAAATGATCAAGAAAAGAATTCTGAAGAAGACAGTCAGTAA
Antitoxin
Download Length: 58 bp
>AT231957 NZ_CP090870:c300413-300356 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|