Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1929867..1930049 | Replicon | chromosome |
Accession | NC_010079 | ||
Organism | Staphylococcus aureus subsp. aureus USA300 TCH1516 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | USA300HOU_RS15780 | Protein ID | WP_001801861.1 |
Coordinates | 1929867..1929962 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1929990..1930049 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
USA300HOU_RS09550 | 1925527..1926153 | + | 627 | Protein_1843 | hypothetical protein | - |
USA300HOU_RS09555 | 1926194..1926538 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
USA300HOU_RS09560 | 1926636..1927187 | + | 552 | WP_000414205.1 | hypothetical protein | - |
USA300HOU_RS09565 | 1927405..1928046 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
USA300HOU_RS09570 | 1928160..1928345 | - | 186 | WP_000809857.1 | hypothetical protein | - |
USA300HOU_RS09575 | 1928347..1928523 | - | 177 | WP_000375476.1 | hypothetical protein | - |
USA300HOU_RS09580 | 1928534..1928917 | - | 384 | WP_000070811.1 | hypothetical protein | - |
USA300HOU_RS09590 | 1929521..1929664 | - | 144 | WP_001549059.1 | transposase | - |
USA300HOU_RS15780 | 1929867..1929962 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1929990..1930049 | - | 60 | - | - | Antitoxin |
USA300HOU_RS09595 | 1930085..1930186 | + | 102 | WP_001791893.1 | hypothetical protein | - |
USA300HOU_RS15375 | 1930164..1930340 | - | 177 | Protein_1853 | transposase | - |
USA300HOU_RS09600 | 1930534..1930911 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1922967..1963137 | 40170 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T22542 WP_001801861.1 NC_010079:1929867-1929962 [Staphylococcus aureus subsp. aureus USA300_TCH1516]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T22542 NC_010079:1929867-1929962 [Staphylococcus aureus subsp. aureus USA300_TCH1516]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT22542 NC_010079:c1930049-1929990 [Staphylococcus aureus subsp. aureus USA300_TCH1516]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|