Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1935727..1935907 | Replicon | chromosome |
| Accession | NC_009782 | ||
| Organism | Staphylococcus aureus subsp. aureus Mu3 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | SAHV_RS15495 | Protein ID | WP_001801861.1 |
| Coordinates | 1935727..1935822 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1935850..1935907 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAHV_RS09515 | 1930890..1931540 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| SAHV_RS09520 | 1931621..1932616 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| SAHV_RS09525 | 1932691..1933317 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| SAHV_RS09530 | 1933358..1933699 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| SAHV_RS09535 | 1933800..1934372 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| SAHV_RS15115 | 1934570..1935582 | - | 1013 | Protein_1840 | IS3 family transposase | - |
| SAHV_RS15495 | 1935727..1935822 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1935850..1935907 | - | 58 | - | - | Antitoxin |
| SAHV_RS09555 | 1935945..1936046 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| SAHV_RS15500 | 1936024..1936185 | - | 162 | Protein_1843 | transposase | - |
| SAHV_RS09560 | 1936176..1936670 | - | 495 | Protein_1844 | transposase | - |
| SAHV_RS09565 | 1937122..1938351 | - | 1230 | WP_000072626.1 | restriction endonuclease subunit S | - |
| SAHV_RS09570 | 1938344..1939900 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| SAHV_RS09575 | 1940064..1940198 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1930926..1971705 | 40779 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T22376 WP_001801861.1 NC_009782:1935727-1935822 [Staphylococcus aureus subsp. aureus Mu3]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T22376 NC_009782:1935727-1935822 [Staphylococcus aureus subsp. aureus Mu3]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT22376 NC_009782:c1935907-1935850 [Staphylococcus aureus subsp. aureus Mu3]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|