Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1979658..1979838 | Replicon | chromosome |
Accession | NC_009487 | ||
Organism | Staphylococcus aureus subsp. aureus JH9 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAURJH9_RS15870 | Protein ID | WP_001801861.1 |
Coordinates | 1979658..1979753 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1979781..1979838 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAURJH9_RS09865 | 1974821..1975471 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SAURJH9_RS09870 | 1975552..1976547 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SAURJH9_RS09875 | 1976622..1977248 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SAURJH9_RS09880 | 1977289..1977630 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SAURJH9_RS09885 | 1977731..1978303 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SAURJH9_RS15520 | 1978501..1979513 | - | 1013 | Protein_1909 | IS3 family transposase | - |
SAURJH9_RS15870 | 1979658..1979753 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1979781..1979838 | - | 58 | - | - | Antitoxin |
SAURJH9_RS09905 | 1979876..1979977 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAURJH9_RS15875 | 1979955..1980116 | - | 162 | Protein_1912 | transposase | - |
SAURJH9_RS09910 | 1980107..1980601 | - | 495 | Protein_1913 | transposase | - |
SAURJH9_RS09915 | 1981053..1982282 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
SAURJH9_RS09920 | 1982275..1983831 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
SAURJH9_RS09925 | 1983995..1984129 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1974062..2005794 | 31732 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T22115 WP_001801861.1 NC_009487:1979658-1979753 [Staphylococcus aureus subsp. aureus JH9]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T22115 NC_009487:1979658-1979753 [Staphylococcus aureus subsp. aureus JH9]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT22115 NC_009487:c1979838-1979781 [Staphylococcus aureus subsp. aureus JH9]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|