Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 1648691..1649217 | Replicon | chromosome |
Accession | NZ_CP084896 | ||
Organism | Escherichia coli strain g62 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | LHV62_RS08130 | Protein ID | WP_000323025.1 |
Coordinates | 1648691..1648978 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | LHV62_RS08135 | Protein ID | WP_000534858.1 |
Coordinates | 1648978..1649217 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LHV62_RS08080 (1643715) | 1643715..1643930 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
LHV62_RS08085 (1644150) | 1644150..1644320 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
LHV62_RS08090 (1644684) | 1644684..1644899 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
LHV62_RS08095 (1645200) | 1645200..1645412 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
LHV62_RS08100 (1645467) | 1645467..1645556 | + | 90 | WP_120795389.1 | hypothetical protein | - |
LHV62_RS08105 (1645834) | 1645834..1646586 | - | 753 | WP_001047135.1 | antitermination protein | - |
LHV62_RS08110 (1646600) | 1646600..1647649 | - | 1050 | WP_001393597.1 | DUF968 domain-containing protein | - |
LHV62_RS08115 (1647651) | 1647651..1647929 | - | 279 | WP_012304870.1 | hypothetical protein | - |
LHV62_RS08120 (1647996) | 1647996..1648247 | - | 252 | WP_000980994.1 | protein Rem | - |
LHV62_RS08125 (1648464) | 1648464..1648619 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
LHV62_RS08130 (1648691) | 1648691..1648978 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
LHV62_RS08135 (1648978) | 1648978..1649217 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
LHV62_RS08140 (1649242) | 1649242..1649547 | + | 306 | WP_001326990.1 | protein YdfV | - |
LHV62_RS08145 (1649750) | 1649750..1650082 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
LHV62_RS08150 (1650519) | 1650519..1650668 | - | 150 | WP_011443592.1 | protein YdfW | - |
LHV62_RS08155 (1650703) | 1650703..1650981 | - | 279 | Protein_1594 | hypothetical protein | - |
LHV62_RS08160 (1650965) | 1650965..1651195 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
LHV62_RS08165 (1651279) | 1651279..1651686 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
LHV62_RS08170 (1651853) | 1651853..1652008 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
LHV62_RS22615 (1652010) | 1652010..1652138 | + | 129 | WP_000344964.1 | protein YdfB | - |
LHV62_RS08175 (1652168) | 1652168..1652386 | + | 219 | WP_001171942.1 | protein YdfC | - |
LHV62_RS08180 (1652954) | 1652954..1653142 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
LHV62_RS08185 (1653139) | 1653139..1653330 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
LHV62_RS08190 (1653423) | 1653423..1654190 | + | 768 | Protein_1602 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 1618149..1672937 | 54788 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T219956 WP_000323025.1 NZ_CP084896:c1648978-1648691 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T219956 NZ_CP116903:2219840-2219942 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT219956 WP_000534858.1 NZ_CP084896:c1649217-1648978 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT219956 NZ_CP116903:c2219949-2219804 [Klebsiella pneumoniae]
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
TAAAGATAAAAAGAGACCGAATACGATTCCTGTATTCGGTCCAGGGAAATGGCTCTTGGGAGAGAGCCGTGCGCTAAAAG
TTGGCATTAATGCAGGCTAAGTCGCCTTGCACTATAAGAATAGTTTAACGCGTCAGCTTTTCCAGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|