Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 1412969..1413194 Replicon chromosome
Accession NC_008258
Organism Shigella flexneri 5 str. 8401

Toxin (Protein)


Gene name hokW Uniprot ID S1ELB5
Locus tag SFV_RS07600 Protein ID WP_000813254.1
Coordinates 1413039..1413194 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 1412969..1413027 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SFV_RS28465 1408546..1408800 + 255 Protein_1395 hypothetical protein -
SFV_RS07560 1409293..1410039 + 747 WP_000788995.1 ATP-binding protein -
SFV_RS07565 1410054..1410476 + 423 WP_001118167.1 DUF977 family protein -
SFV_RS07570 1410534..1410890 + 357 WP_005048249.1 hypothetical protein -
SFV_RS07575 1410983..1411201 + 219 WP_000256998.1 DUF4014 family protein -
SFV_RS07580 1411203..1411568 + 366 WP_001229298.1 HNH endonuclease -
SFV_RS07585 1411565..1412230 + 666 WP_000208062.1 hypothetical protein -
SFV_RS25345 1412344..1412584 + 241 Protein_1402 DUF551 domain-containing protein -
- 1412969..1413027 - 59 - - Antitoxin
SFV_RS07600 1413039..1413194 + 156 WP_000813254.1 type I toxin-antitoxin system toxin HokD Toxin
SFV_RS07610 1413700..1414397 - 698 Protein_1404 IS1 family transposase -
SFV_RS07620 1414531..1415130 + 600 WP_000940330.1 DUF1367 family protein -
SFV_RS07625 1415130..1415420 + 291 WP_000228038.1 DUF1364 domain-containing protein -
SFV_RS07630 1415417..1415971 + 555 WP_000640145.1 DUF1133 family protein -
SFV_RS07655 1416586..1418190 + 1605 WP_000615492.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage sitABCD ipaH9.8 1403810..1455338 51528
flank IS/Tn - - 1413700..1414203 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5736.89 Da        Isoelectric Point: 6.1531

>T21651 WP_000813254.1 NC_008258:1413039-1413194 [Shigella flexneri 5 str. 8401]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE

Download         Length: 156 bp

>T21651 NC_008258:1413039-1413194 [Shigella flexneri 5 str. 8401]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAATCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA

Antitoxin


Download         Length: 59 bp

>AT21651 NC_008258:c1413027-1412969 [Shigella flexneri 5 str. 8401]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATTTGTGAGACATAGATTGGGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A4P7TMW0

Antitoxin

Download structure file

References