Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2118767..2118992 | Replicon | chromosome |
Accession | NZ_CP082835 | ||
Organism | Escherichia coli strain 1613 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | K8O78_RS10450 | Protein ID | WP_000813258.1 |
Coordinates | 2118767..2118922 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2118934..2118992 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
K8O78_RS10400 | 2113770..2114201 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
K8O78_RS10415 | 2114652..2115365 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
K8O78_RS10420 | 2115501..2115698 | - | 198 | WP_000917763.1 | hypothetical protein | - |
K8O78_RS10425 | 2115923..2116477 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
K8O78_RS10430 | 2116540..2116845 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
K8O78_RS10435 | 2116858..2117907 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
K8O78_RS10440 | 2117909..2118181 | - | 273 | WP_000191872.1 | hypothetical protein | - |
K8O78_RS10445 | 2118303..2118647 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
K8O78_RS10450 | 2118767..2118922 | - | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
- | 2118934..2118992 | + | 59 | - | - | Antitoxin |
K8O78_RS10455 | 2119213..2119770 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
K8O78_RS10460 | 2119772..2119990 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
K8O78_RS10465 | 2120118..2120429 | - | 312 | WP_001289673.1 | hypothetical protein | - |
K8O78_RS10470 | 2120422..2120649 | - | 228 | WP_000699809.1 | hypothetical protein | - |
K8O78_RS10475 | 2120646..2120927 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
K8O78_RS10480 | 2120960..2121676 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
K8O78_RS10485 | 2121710..2122171 | - | 462 | WP_000139447.1 | replication protein P | - |
K8O78_RS10490 | 2122164..2123207 | - | 1044 | WP_001262402.1 | DnaT-like ssDNA-binding domain-containing protein | - |
K8O78_RS10495 | 2123276..2123701 | - | 426 | WP_000693878.1 | toxin YdaT family protein | - |
K8O78_RS10500 | 2123685..2123927 | - | 243 | WP_000747948.1 | Cro/CI family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | nleG7' | 2081662..2180761 | 99099 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T215373 WP_000813258.1 NZ_CP082835:c2118922-2118767 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T215373 NZ_CP110664:1503344-1503604 [Actinobacillus pleuropneumoniae]
ATGAAGCTAACTTTCTCGTCTAATGCGTGGGAAGATTATTTATACTGGCAAAAAACCGATAAAATAATTTTGAAACGTAT
AAACAGCCTGATCAAAGATATTCAACGCCAACCATTCGAAGGCATAGGAAAACTGGAGCCGCTAAAATTCAATCTTTCGG
GATTTTGGTCAAGGCGAATCAATGAAGAACACCGCTTAATTTACAGCGTGGAAGATGAAGCAATTTTAATAGTAGCGTGT
AGATACCATTATGATCAGTAA
ATGAAGCTAACTTTCTCGTCTAATGCGTGGGAAGATTATTTATACTGGCAAAAAACCGATAAAATAATTTTGAAACGTAT
AAACAGCCTGATCAAAGATATTCAACGCCAACCATTCGAAGGCATAGGAAAACTGGAGCCGCTAAAATTCAATCTTTCGG
GATTTTGGTCAAGGCGAATCAATGAAGAACACCGCTTAATTTACAGCGTGGAAGATGAAGCAATTTTAATAGTAGCGTGT
AGATACCATTATGATCAGTAA
Antitoxin
Download Length: 59 bp
>AT215373 NZ_CP082835:2118934-2118992 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|