Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 954068..954882 | Replicon | chromosome |
Accession | NZ_CP075108 | ||
Organism | Salmonella enterica strain CFSAN060808 |
Toxin (Protein)
Gene name | TacT3 | Uniprot ID | B5RDM7 |
Locus tag | CIC23_RS04535 | Protein ID | WP_000971654.1 |
Coordinates | 954068..954595 (-) | Length | 176 a.a. |
Antitoxin (Protein)
Gene name | TacA3 | Uniprot ID | M7S6I2 |
Locus tag | CIC23_RS04540 | Protein ID | WP_000855694.1 |
Coordinates | 954592..954882 (-) | Length | 97 a.a. |
Genomic Context
Location: 950361..950759 (399 bp)
Type: Others
Protein ID: Protein_884
Type: Others
Protein ID: Protein_884
Location: 950978..951196 (219 bp)
Type: Others
Protein ID: Protein_885
Type: Others
Protein ID: Protein_885
Location: 951353..952021 (669 bp)
Type: Others
Protein ID: WP_000445914.1
Type: Others
Protein ID: WP_000445914.1
Location: 952048..952542 (495 bp)
Type: Others
Protein ID: WP_000424948.1
Type: Others
Protein ID: WP_000424948.1
Location: 953772..953995 (224 bp)
Type: Others
Protein ID: Protein_889
Type: Others
Protein ID: Protein_889
Location: 955582..955908 (327 bp)
Type: Others
Protein ID: WP_000393302.1
Type: Others
Protein ID: WP_000393302.1
Location: 958292..958942 (651 bp)
Type: Others
Protein ID: WP_001674874.1
Type: Others
Protein ID: WP_001674874.1
Location: 952787..953443 (657 bp)
Type: Others
Protein ID: WP_000420452.1
Type: Others
Protein ID: WP_000420452.1
Location: 954068..954595 (528 bp)
Type: Toxin
Protein ID: WP_000971654.1
Type: Toxin
Protein ID: WP_000971654.1
Location: 954592..954882 (291 bp)
Type: Antitoxin
Protein ID: WP_000855694.1
Type: Antitoxin
Protein ID: WP_000855694.1
Location: 955152..955341 (190 bp)
Type: Others
Protein ID: Protein_892
Type: Others
Protein ID: Protein_892
Location: 956181..956528 (348 bp)
Type: Others
Protein ID: WP_001669174.1
Type: Others
Protein ID: WP_001669174.1
Location: 956513..956962 (450 bp)
Type: Others
Protein ID: WP_052929768.1
Type: Others
Protein ID: WP_052929768.1
Location: 957393..957836 (444 bp)
Type: Others
Protein ID: WP_052929766.1
Type: Others
Protein ID: WP_052929766.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CIC23_RS04505 (950361) | 950361..950759 | + | 399 | Protein_884 | cytoplasmic protein | - |
CIC23_RS04510 (950978) | 950978..951196 | + | 219 | Protein_885 | hypothetical protein | - |
CIC23_RS04515 (951353) | 951353..952021 | + | 669 | WP_000445914.1 | hypothetical protein | - |
CIC23_RS04520 (952048) | 952048..952542 | + | 495 | WP_000424948.1 | hypothetical protein | - |
CIC23_RS04525 (952787) | 952787..953443 | - | 657 | WP_000420452.1 | protein-serine/threonine phosphatase | - |
CIC23_RS04530 (953772) | 953772..953995 | + | 224 | Protein_889 | IS5/IS1182 family transposase | - |
CIC23_RS04535 (954068) | 954068..954595 | - | 528 | WP_000971654.1 | GNAT family N-acetyltransferase | Toxin |
CIC23_RS04540 (954592) | 954592..954882 | - | 291 | WP_000855694.1 | DUF1778 domain-containing protein | Antitoxin |
CIC23_RS04545 (955152) | 955152..955341 | - | 190 | Protein_892 | IS3 family transposase | - |
CIC23_RS04550 (955582) | 955582..955908 | + | 327 | WP_000393302.1 | hypothetical protein | - |
CIC23_RS04555 (956181) | 956181..956528 | - | 348 | WP_001669174.1 | DUF1493 family protein | - |
CIC23_RS04560 (956513) | 956513..956962 | - | 450 | WP_052929768.1 | hypothetical protein | - |
CIC23_RS04565 (957393) | 957393..957836 | - | 444 | WP_052929766.1 | SPI-1 type III secretion system invasion lipoprotein InvH | - |
CIC23_RS04570 (958292) | 958292..958942 | + | 651 | WP_001674874.1 | type III secretion system transcriptional activator InvF | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | invH / invF / invG / invE / invA / invB | 953819..964255 | 10436 | ||
- | flank | IS/Tn | - | - | 953819..953995 | 176 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 176 a.a. Molecular weight: 19041.85 Da Isoelectric Point: 9.6420
>T202845 WP_000971654.1 NZ_CP075108:c954595-954068 [Salmonella enterica]
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
MMFTDWHEAAIGKTHNRMNFDCGDADLNQFLQRHARQNHEKGTTKTYVALDNSDVTRIHGFYSVSPASLIYAQVPGAISK
GLGRYDVPVFRLGRLAVDKSMQGQGLGAQLLLSAGKRCIQAALQVGGVALLIDAKNKQACDWYKGFGAVPLNDQPLSLLL
SFKTLYAALSASGRL
Download Length: 528 bp
>T202845 NZ_CP099721:178593-178700 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAATAAGCGGAAGTAA
Antitoxin
Download Length: 97 a.a. Molecular weight: 10664.50 Da Isoelectric Point: 6.3133
>AT202845 WP_000855694.1 NZ_CP075108:c954882-954592 [Salmonella enterica]
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
MKTMPQIAIESNERLSLRVSTDAKKLIVRAAAIQQTNLTDFVVSNVLPVAQKIVDAAERVYLTERDTQMIMEILDNPPAP
NEKLLAAAFALPDMKK
Download Length: 291 bp
>AT202845 NZ_CP099721:c178536-178479 [Escherichia coli]
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
TCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Y9PNF0 |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3V8SJE7 |