Detailed information of TA system TA202698

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): hicAB/HicA-HicB
• Location: 1888291..1888970
• Replicon: chromosome
• Accession: NZ_CP074710
• Organism: Acinetobacter baumannii strain ATCC 17978

Toxin (Protein)

• Gene name: hicA
• Uniprot ID: S3TWT7
• Locus tag: KIP77_RS10025
• Protein ID: WP_000838146.1
• Coordinates: 1888291..1888473 (+)
• Length: 61 a.a.

Antitoxin (Protein)

• Gene name: hicB
• Uniprot ID: N9L2H6
• Locus tag: KIP77_RS10030
• Protein ID: WP_000966688.1
• Coordinates: 1888566..1888970 (+)
• Length: 135 a.a.

Genomic Context

Location: 1883534..1883932 (399 bp)
Type: Others
Protein ID: WP_001251846.1

Location: 1883934..1884152 (219 bp)
Type: Others
Protein ID: WP_001277696.1

Location: 1884261..1884782 (522 bp)
Type: Others
Protein ID: WP_000749906.1

Location: 1884879..1885232 (354 bp)
Type: Others
Protein ID: WP_000064603.1

Location: 1885232..1886410 (1179 bp)
Type: Others
Protein ID: WP_000002414.1

Location: 1886463..1887380 (918 bp)
Type: Others
Protein ID: WP_000094261.1

Location: 1887450..1887965 (516 bp)
Type: Others
Protein ID: WP_001185604.1

Location: 1888291..1888473 (183 bp)
Type: Toxin
Protein ID: WP_000838146.1

Location: 1888566..1888970 (405 bp)
Type: Antitoxin
Protein ID: WP_000966688.1

Location: 1889070..1889246 (177 bp)
Type: Others
Protein ID: WP_074031683.1

Location: 1889255..1889578 (324 bp)
Type: Others
Protein ID: WP_000523932.1

Location: 1889612..1890001 (390 bp)
Type: Others
Protein ID: WP_031977960.1

Loading, please wait

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
KIP77_RS09990 (KIP77_09955)	1883534..1883932	+	399	WP_001251846.1	phage tail terminator-like protein	-
KIP77_RS09995 (KIP77_09960)	1883934..1884152	+	219	WP_001277696.1	hypothetical protein	-
KIP77_RS10000 (KIP77_09965)	1884261..1884782	+	522	WP_000749906.1	SH3 domain-containing protein	-
KIP77_RS10005 (KIP77_09970)	1884879..1885232	+	354	WP_000064603.1	hypothetical protein	-
KIP77_RS10010 (KIP77_09975)	1885232..1886410	+	1179	WP_000002414.1	hypothetical protein	-
KIP77_RS10015 (KIP77_09980)	1886463..1887380	+	918	WP_000094261.1	phage tail tube protein	-
KIP77_RS10020 (KIP77_09985)	1887450..1887965	+	516	WP_001185604.1	hypothetical protein	-
KIP77_RS10025 (KIP77_09990)	1888291..1888473	+	183	WP_000838146.1	type II toxin-antitoxin system HicA family toxin	Toxin
KIP77_RS10030 (KIP77_09995)	1888566..1888970	+	405	WP_000966688.1	type II toxin-antitoxin system HicB family antitoxin	Antitoxin
KIP77_RS10035 (KIP77_10000)	1889070..1889246	+	177	WP_074031683.1	hypothetical protein	-
KIP77_RS10040 (KIP77_10005)	1889255..1889578	+	324	WP_000523932.1	DUF4236 domain-containing protein	-
KIP77_RS10045 (KIP77_10010)	1889612..1890001	+	390	WP_031977960.1	hypothetical protein	-

Associated MGEs

Loading, please wait

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_009085 Acinetobacter baumannii ATCC 17978 Prophage TA003593 2330900..2386278 0.003 View NZ_CP018664 Acinetobacter baumannii strain ATCC 17978 Prophage TA070152 3749028..3798366 0	inside	Prophage	-	-	1854267..1903605	49338

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• HicA mRNA interferase family (5-59)

Antitoxin

• HicB-like antitoxin of toxin-antitoxin system (3-126)

Sequences

Toxin

Protein

• Length: 61 a.a.
• Molecular weight: 6695.84 Da
• Isoelectric Point: 10.5523

>T202698 WP_000838146.1 NZ_CP074710:1888291-1888473 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPNGTVKSILKQAGLN

Nucleotide

• Length: 183 bp

>T202698 NZ_CP099590:183644-183751 [Escherichia coli]
ATGACGTTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin

Protein

• Length: 135 a.a.
• Molecular weight: 14647.69 Da
• Isoelectric Point: 4.4328

>AT202698 WP_000966688.1 NZ_CP074710:1888566-1888970 [Acinetobacter baumannii]
MLYPIAIERGSDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASELVKFVDDPEYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Nucleotide

• Length: 405 bp

>AT202698 NZ_CP099590:c183595-183532 [Escherichia coli]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Toxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Antitoxin

Loading, please wait

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
No matching records found

Showing 1 to 0 of 0 rows

10

rows per page

• ‹
• ›

Structures

Toxin

Loading, please wait

• AlphaFold DB: S3TWT7

Antitoxin

Loading, please wait

• AlphaFold DB: N9L2H6