Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2174430..2174956 | Replicon | chromosome |
Accession | NZ_CP067299 | ||
Organism | Escherichia coli strain ABW_A33 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | JJB24_RS10465 | Protein ID | WP_000323025.1 |
Coordinates | 2174430..2174717 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | JJB24_RS10470 | Protein ID | WP_000534858.1 |
Coordinates | 2174717..2174956 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JJB24_RS10420 (2169454) | 2169454..2169669 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
JJB24_RS23645 (2169889) | 2169889..2170059 | + | 171 | WP_211180497.1 | putative zinc-binding protein YnfU | - |
JJB24_RS10425 (2170423) | 2170423..2170638 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
JJB24_RS10430 (2170939) | 2170939..2171151 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
JJB24_RS10435 (2171206) | 2171206..2171295 | + | 90 | WP_120795389.1 | hypothetical protein | - |
JJB24_RS10440 (2171573) | 2171573..2172325 | - | 753 | WP_001047135.1 | antitermination protein | - |
JJB24_RS10445 (2172339) | 2172339..2173388 | - | 1050 | WP_001265199.1 | DUF968 domain-containing protein | - |
JJB24_RS10450 (2173390) | 2173390..2173668 | - | 279 | WP_012304870.1 | hypothetical protein | - |
JJB24_RS10455 (2173735) | 2173735..2173986 | - | 252 | WP_000980994.1 | protein Rem | - |
JJB24_RS10460 (2174203) | 2174203..2174358 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
JJB24_RS10465 (2174430) | 2174430..2174717 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
JJB24_RS10470 (2174717) | 2174717..2174956 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
JJB24_RS10475 (2174981) | 2174981..2175286 | + | 306 | WP_001326990.1 | protein YdfV | - |
JJB24_RS10485 (2176266) | 2176266..2176598 | + | 333 | WP_001301033.1 | FlxA-like family protein | - |
JJB24_RS23795 (2177035) | 2177035..2177184 | - | 150 | WP_011443592.1 | protein YdfW | - |
JJB24_RS10490 (2177305) | 2177305..2178327 | - | 1023 | Protein_2077 | ISNCY family transposase | - |
JJB24_RS10495 (2179117) | 2179117..2179404 | - | 288 | Protein_2078 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2143045..2203758 | 60713 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T186007 WP_000323025.1 NZ_CP067299:c2174717-2174430 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T186007 NZ_CP089142:2716197-2716304 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT186007 WP_000534858.1 NZ_CP067299:c2174956-2174717 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT186007 NZ_CP089142:c2716150-2716084 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|