Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 173212..173392 | Replicon | chromosome |
Accession | NZ_CP062417 | ||
Organism | Staphylococcus aureus strain NAS_AN_143 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF718_RS01080 | Protein ID | WP_001801861.1 |
Coordinates | 173297..173392 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 173212..173269 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF718_RS01050 | 168921..169055 | + | 135 | WP_001791797.1 | hypothetical protein | - |
IF718_RS01055 | 169219..170775 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
IF718_RS01060 | 170768..171997 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
IF718_RS01065 | 172539..172949 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
IF718_RS01070 | 172934..173095 | + | 162 | Protein_175 | transposase | - |
IF718_RS01075 | 173073..173174 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 173212..173269 | + | 58 | - | - | Antitoxin |
IF718_RS01080 | 173297..173392 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
IF718_RS01085 | 173537..174549 | + | 1013 | Protein_178 | IS3 family transposase | - |
IF718_RS01090 | 174747..175319 | - | 573 | WP_000414216.1 | hypothetical protein | - |
IF718_RS01095 | 175420..175761 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
IF718_RS01100 | 175802..176428 | - | 627 | WP_000669024.1 | hypothetical protein | - |
IF718_RS01105 | 176503..177498 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
IF718_RS01110 | 177579..178229 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 148311..178193 | 29882 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T175172 WP_001801861.1 NZ_CP062417:c173392-173297 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T175172 NZ_CP081791:2069704-2069807 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT175172 NZ_CP062417:173212-173269 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|