Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 179043..179225 | Replicon | chromosome |
Accession | NZ_CP062376 | ||
Organism | Staphylococcus aureus strain NAS_AN_099 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF707_RS01080 | Protein ID | WP_001801861.1 |
Coordinates | 179130..179225 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 179043..179102 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF707_RS01065 | 178181..178558 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
IF707_RS01070 | 178752..178928 | + | 177 | Protein_173 | transposase | - |
IF707_RS01075 | 178906..179007 | - | 102 | WP_001791893.1 | hypothetical protein | - |
- | 179043..179102 | + | 60 | - | - | Antitoxin |
IF707_RS01080 | 179130..179225 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
IF707_RS01085 | 179428..179571 | + | 144 | WP_001549059.1 | transposase | - |
IF707_RS01090 | 180175..180558 | + | 384 | WP_000070811.1 | hypothetical protein | - |
IF707_RS01095 | 180569..180745 | + | 177 | WP_000375477.1 | hypothetical protein | - |
IF707_RS01100 | 181048..181676 | + | 629 | Protein_179 | ImmA/IrrE family metallo-endopeptidase | - |
IF707_RS01105 | 181874..182446 | - | 573 | WP_045177260.1 | hypothetical protein | - |
IF707_RS01110 | 182547..182888 | - | 342 | WP_045177258.1 | DUF3969 family protein | - |
IF707_RS01115 | 182929..183555 | - | 627 | WP_045177256.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | hlgA / lukD | 146199..186115 | 39916 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T174690 WP_001801861.1 NZ_CP062376:c179225-179130 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T174690 NZ_CP081351:2278797-2278900 [Klebsiella michiganensis]
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT174690 NZ_CP062376:179043-179102 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|