Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 173837..174017 | Replicon | chromosome |
Accession | NZ_CP062368 | ||
Organism | Staphylococcus aureus strain NAS_AN_115 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | IF712_RS01080 | Protein ID | WP_001801861.1 |
Coordinates | 173922..174017 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 173837..173894 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
IF712_RS01050 | 169546..169680 | + | 135 | WP_001791797.1 | hypothetical protein | - |
IF712_RS01055 | 169844..171400 | + | 1557 | WP_000028659.1 | type I restriction-modification system subunit M | - |
IF712_RS01060 | 171393..172622 | + | 1230 | WP_240021979.1 | restriction endonuclease subunit S | - |
IF712_RS01065 | 173164..173574 | + | 411 | WP_001808705.1 | IS21 family transposase | - |
IF712_RS01070 | 173559..173720 | + | 162 | Protein_175 | transposase | - |
IF712_RS01075 | 173698..173799 | - | 102 | WP_001792025.1 | hypothetical protein | - |
- | 173837..173894 | + | 58 | - | - | Antitoxin |
IF712_RS01080 | 173922..174017 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
IF712_RS01085 | 174162..175174 | + | 1013 | Protein_178 | IS3 family transposase | - |
IF712_RS01090 | 175372..175944 | - | 573 | WP_000414216.1 | hypothetical protein | - |
IF712_RS01095 | 176045..176386 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
IF712_RS01100 | 176427..177053 | - | 627 | WP_000669024.1 | hypothetical protein | - |
IF712_RS01105 | 177128..178123 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
IF712_RS01110 | 178204..178854 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | selk / hlgA / lukD | 147784..178818 | 31034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T174646 WP_001801861.1 NZ_CP062368:c174017-173922 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T174646 NZ_CP081307:c58795-58661 [Escherichia coli]
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
ATGACGAAATATACCCTTATCGGGTTGCTTGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACAGTT
ATGTGAACTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTGA
Antitoxin
Download Length: 58 bp
>AT174646 NZ_CP062368:173837-173894 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|