Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2078382..2078908 | Replicon | chromosome |
Accession | NZ_CP058948 | ||
Organism | Escherichia coli strain SY3626C5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | HZ988_RS10120 | Protein ID | WP_000323025.1 |
Coordinates | 2078382..2078669 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | S1F6D3 |
Locus tag | HZ988_RS10125 | Protein ID | WP_000534858.1 |
Coordinates | 2078669..2078908 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HZ988_RS10075 | 2073406..2073621 | - | 216 | WP_000839590.1 | phage lysis protein EssD | - |
HZ988_RS10080 | 2074375..2074590 | - | 216 | WP_000066484.1 | cold shock-like protein CspB | - |
HZ988_RS10085 | 2074891..2075103 | + | 213 | WP_000087756.1 | cold shock-like protein CspF | - |
HZ988_RS10090 | 2075158..2075247 | + | 90 | WP_120795389.1 | hypothetical protein | - |
HZ988_RS10095 | 2075525..2076277 | - | 753 | WP_001047135.1 | antitermination protein | - |
HZ988_RS10100 | 2076291..2077340 | - | 1050 | WP_001265198.1 | DUF968 domain-containing protein | - |
HZ988_RS10105 | 2077342..2077620 | - | 279 | WP_012304870.1 | hypothetical protein | - |
HZ988_RS10110 | 2077687..2077938 | - | 252 | WP_000980994.1 | hypothetical protein | - |
HZ988_RS10115 | 2078155..2078310 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | - |
HZ988_RS10120 | 2078382..2078669 | - | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
HZ988_RS10125 | 2078669..2078908 | - | 240 | WP_000534858.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
HZ988_RS10130 | 2078933..2079238 | + | 306 | WP_001326990.1 | hypothetical protein | - |
HZ988_RS10135 | 2079441..2079773 | + | 333 | WP_001301033.1 | protein FlxA | - |
HZ988_RS10140 | 2080210..2080359 | - | 150 | WP_011443592.1 | hypothetical protein | - |
HZ988_RS10145 | 2080394..2080672 | - | 279 | Protein_1988 | hypothetical protein | - |
HZ988_RS10150 | 2080656..2080886 | - | 231 | WP_000920568.1 | dicB transcriptional regulator DicC | - |
HZ988_RS10155 | 2080970..2081377 | + | 408 | WP_000448564.1 | DNA-binding transcriptional dual regulator DicA | - |
HZ988_RS10160 | 2081544..2081699 | + | 156 | WP_000379575.1 | DUF1391 family protein | - |
HZ988_RS10165 | 2081859..2082077 | + | 219 | WP_001171942.1 | hypothetical protein | - |
HZ988_RS10170 | 2082645..2082833 | + | 189 | WP_000854559.1 | cell division inhibition protein DicB | - |
HZ988_RS10175 | 2082830..2083021 | + | 192 | WP_001083297.1 | lysis protein YdfD | - |
HZ988_RS10180 | 2083114..2083881 | + | 768 | Protein_1995 | exonuclease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | - | 2064038..2085744 | 21706 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T168003 WP_000323025.1 NZ_CP058948:c2078669-2078382 [Escherichia coli]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T168003 NZ_CP075562:c2000276-2000169 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9071.48 Da Isoelectric Point: 4.5230
>AT168003 WP_000534858.1 NZ_CP058948:c2078908-2078669 [Escherichia coli]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLRNPKPVRVTLDEL
Download Length: 240 bp
>AT168003 NZ_CP075562:2000092-2000152 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|