Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 174453..174633 | Replicon | chromosome |
| Accession | NZ_CP047867 | ||
| Organism | Staphylococcus aureus strain UP_419 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | E3S59_RS01085 | Protein ID | WP_001801861.1 |
| Coordinates | 174538..174633 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 174453..174510 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3S59_RS01055 | 170162..170296 | + | 135 | WP_001791797.1 | hypothetical protein | - |
| E3S59_RS01060 | 170460..172016 | + | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| E3S59_RS01065 | 172009..173238 | + | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| E3S59_RS01070 | 173690..174184 | + | 495 | Protein_176 | transposase | - |
| E3S59_RS01075 | 174175..174336 | + | 162 | Protein_177 | transposase | - |
| E3S59_RS01080 | 174314..174415 | - | 102 | WP_001792025.1 | hypothetical protein | - |
| - | 174453..174510 | + | 58 | - | - | Antitoxin |
| E3S59_RS01085 | 174538..174633 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| E3S59_RS01090 | 174778..175790 | + | 1013 | Protein_180 | IS3 family transposase | - |
| E3S59_RS01095 | 175988..176560 | - | 573 | WP_000414216.1 | hypothetical protein | - |
| E3S59_RS01100 | 176661..177002 | - | 342 | WP_000627540.1 | DUF3969 family protein | - |
| E3S59_RS01105 | 177043..177669 | - | 627 | WP_000669024.1 | hypothetical protein | - |
| E3S59_RS01110 | 177744..178739 | - | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| E3S59_RS01115 | 178820..179470 | - | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | selk / hlgA / lukD | 147621..179434 | 31813 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T148441 WP_001801861.1 NZ_CP047867:c174633-174538 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T148441 NZ_CP063518:c2013967-2013860 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT148441 NZ_CP047867:174453-174510 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|