Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1081142..1081322 | Replicon | chromosome |
| Accession | NZ_CP045866 | ||
| Organism | Staphylococcus aureus strain CFSAN007894 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | AB466_RS05125 | Protein ID | WP_001801861.1 |
| Coordinates | 1081142..1081237 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1081265..1081322 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB466_RS05095 | 1076305..1076955 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| AB466_RS05100 | 1077036..1078031 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| AB466_RS05105 | 1078106..1078732 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| AB466_RS05110 | 1078773..1079114 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| AB466_RS05115 | 1079215..1079787 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| AB466_RS05120 | 1079985..1080997 | - | 1013 | Protein_1017 | IS3 family transposase | - |
| AB466_RS05125 | 1081142..1081237 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1081265..1081322 | - | 58 | - | - | Antitoxin |
| AB466_RS05130 | 1081360..1081461 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| AB466_RS05135 | 1081439..1081600 | - | 162 | Protein_1020 | transposase | - |
| AB466_RS05140 | 1081591..1082085 | - | 495 | Protein_1021 | transposase | - |
| AB466_RS05145 | 1082537..1083766 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| AB466_RS05150 | 1083759..1085315 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| AB466_RS05155 | 1085479..1085613 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 1075547..1110824 | 35277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T142897 WP_001801861.1 NZ_CP045866:1081142-1081237 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T142897 NZ_CP060899:2606848-2606955 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 58 bp
>AT142897 NZ_CP045866:c1081322-1081265 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|