Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 2707291..2707471 | Replicon | chromosome |
| Accession | NZ_CP042157 | ||
| Organism | Staphylococcus aureus strain B3-17D | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | FP481_RS13625 | Protein ID | WP_001801861.1 |
| Coordinates | 2707291..2707386 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 2707414..2707471 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FP481_RS13595 | 2702454..2703104 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| FP481_RS13600 | 2703185..2704180 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| FP481_RS13605 | 2704255..2704881 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| FP481_RS13610 | 2704922..2705263 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| FP481_RS13615 | 2705364..2705936 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| FP481_RS13620 | 2706134..2707146 | - | 1013 | Protein_2627 | IS3 family transposase | - |
| FP481_RS13625 | 2707291..2707386 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 2707414..2707471 | - | 58 | - | - | Antitoxin |
| FP481_RS13630 | 2707509..2707610 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| FP481_RS13635 | 2707588..2707749 | - | 162 | Protein_2630 | transposase | - |
| FP481_RS13640 | 2707740..2708234 | - | 495 | Protein_2631 | transposase | - |
| FP481_RS13645 | 2708686..2709915 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| FP481_RS13650 | 2709908..2711464 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| FP481_RS13655 | 2711628..2711762 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | lukD / hlgA / selk | 2701696..2734302 | 32606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T134915 WP_001801861.1 NZ_CP042157:2707291-2707386 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T134915 NZ_CP042157:2707291-2707386 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT134915 NZ_CP042157:c2707471-2707414 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|