Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1906685..1906865 | Replicon | chromosome |
Accession | NZ_CP042153 | ||
Organism | Staphylococcus aureus strain B4-59C |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FP482_RS09245 | Protein ID | WP_001801861.1 |
Coordinates | 1906685..1906780 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1906808..1906865 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP482_RS09215 | 1901848..1902498 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FP482_RS09220 | 1902579..1903574 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FP482_RS09225 | 1903649..1904275 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FP482_RS09230 | 1904316..1904657 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FP482_RS09235 | 1904758..1905330 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FP482_RS09240 | 1905528..1906540 | - | 1013 | Protein_1782 | IS3 family transposase | - |
FP482_RS09245 | 1906685..1906780 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1906808..1906865 | - | 58 | - | - | Antitoxin |
FP482_RS09250 | 1906903..1907004 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FP482_RS09255 | 1906982..1907143 | - | 162 | Protein_1785 | transposase | - |
FP482_RS09260 | 1907134..1907628 | - | 495 | Protein_1786 | transposase | - |
FP482_RS09265 | 1908080..1909309 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
FP482_RS09270 | 1909302..1910858 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FP482_RS09275 | 1911022..1911156 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 1901090..1933696 | 32606 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T134888 WP_001801861.1 NZ_CP042153:1906685-1906780 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T134888 NZ_CP042153:1906685-1906780 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT134888 NZ_CP042153:c1906865-1906808 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|