Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2436094..2436274 | Replicon | chromosome |
Accession | NZ_CP042107 | ||
Organism | Staphylococcus aureus strain B8-13D |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FP484_RS12090 | Protein ID | WP_001801861.1 |
Coordinates | 2436094..2436189 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2436217..2436274 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FP484_RS12060 | 2431257..2431907 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
FP484_RS12065 | 2431988..2432983 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
FP484_RS12070 | 2433058..2433684 | + | 627 | WP_000669024.1 | hypothetical protein | - |
FP484_RS12075 | 2433725..2434066 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
FP484_RS12080 | 2434167..2434739 | + | 573 | WP_000414216.1 | hypothetical protein | - |
FP484_RS12085 | 2434937..2435949 | - | 1013 | Protein_2340 | IS3 family transposase | - |
FP484_RS12090 | 2436094..2436189 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 2436217..2436274 | - | 58 | - | - | Antitoxin |
FP484_RS12095 | 2436312..2436413 | + | 102 | WP_001792025.1 | hypothetical protein | - |
FP484_RS12100 | 2436391..2436552 | - | 162 | Protein_2343 | transposase | - |
FP484_RS12105 | 2436543..2437037 | - | 495 | Protein_2344 | transposase | - |
FP484_RS12110 | 2437489..2438718 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
FP484_RS12115 | 2438711..2440267 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
FP484_RS12120 | 2440431..2440565 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA / selk | 2431293..2472071 | 40778 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T134876 WP_001801861.1 NZ_CP042107:2436094-2436189 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T134876 NZ_CP042107:2436094-2436189 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT134876 NZ_CP042107:c2436274-2436217 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|