Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1928344..1928526 | Replicon | chromosome |
Accession | NZ_CP040622 | ||
Organism | Staphylococcus aureus strain JKD6004 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | FF958_RS09545 | Protein ID | WP_001801861.1 |
Coordinates | 1928344..1928439 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1928467..1928526 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
FF958_RS09495 | 1924004..1924630 | + | 627 | WP_000669046.1 | hypothetical protein | - |
FF958_RS09500 | 1924671..1925015 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
FF958_RS09505 | 1925113..1925664 | + | 552 | WP_000414205.1 | hypothetical protein | - |
FF958_RS09510 | 1925882..1926523 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
FF958_RS09515 | 1926637..1926822 | - | 186 | WP_000809857.1 | hypothetical protein | - |
FF958_RS09520 | 1926824..1927000 | - | 177 | WP_000375476.1 | hypothetical protein | - |
FF958_RS09525 | 1927011..1927394 | - | 384 | WP_000070811.1 | hypothetical protein | - |
FF958_RS09535 | 1927998..1928141 | - | 144 | WP_001549059.1 | transposase | - |
FF958_RS09545 | 1928344..1928439 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1928467..1928526 | - | 60 | - | - | Antitoxin |
FF958_RS09550 | 1928562..1928663 | + | 102 | WP_001791893.1 | hypothetical protein | - |
FF958_RS09555 | 1928641..1928817 | - | 177 | Protein_1831 | transposase | - |
FF958_RS09560 | 1929011..1929388 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1921444..1960363 | 38919 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T126174 WP_001801861.1 NZ_CP040622:1928344-1928439 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T126174 NZ_CP040622:1928344-1928439 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT126174 NZ_CP040622:c1928526-1928467 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|