Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 2615166..2615391 Replicon chromosome
Accession NZ_CP038421
Organism Escherichia coli O157:H7 strain 7636

Toxin (Protein)


Gene name hokW Uniprot ID -
Locus tag E3152_RS13225 Protein ID WP_000935259.1
Coordinates 2615179..2615391 (+) Length 71 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 2615166..2615224 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E3152_RS13175 2610231..2610473 + 243 WP_000747948.1 hypothetical protein -
E3152_RS13180 2610457..2610882 + 426 WP_000693878.1 Rha family transcriptional regulator -
E3152_RS13185 2610951..2611994 + 1044 WP_001262402.1 hypothetical protein -
E3152_RS13190 2611987..2612448 + 462 WP_000139447.1 replication protein -
E3152_RS13195 2612482..2613198 + 717 WP_000450627.1 DUF1627 domain-containing protein -
E3152_RS13200 2613231..2613512 + 282 WP_000603384.1 DNA-binding protein -
E3152_RS13205 2613509..2613736 + 228 WP_000699809.1 hypothetical protein -
E3152_RS13210 2613729..2614040 + 312 WP_001289673.1 hypothetical protein -
E3152_RS13215 2614168..2614386 + 219 WP_000683609.1 DUF4014 family protein -
E3152_RS13220 2614388..2614945 + 558 WP_000104474.1 DUF551 domain-containing protein -
- 2615166..2615224 - 59 - - Antitoxin
E3152_RS13225 2615179..2615391 + 213 WP_000935259.1 type I toxin-antitoxin system Hok family toxin Toxin
E3152_RS13230 2615511..2615855 + 345 WP_000756596.1 YgiW/YdeI family stress tolerance OB fold protein -
E3152_RS13235 2615977..2616249 + 273 WP_000191872.1 hypothetical protein -
E3152_RS13240 2616251..2617300 + 1050 WP_001265229.1 DUF968 domain-containing protein -
E3152_RS13245 2617313..2617618 + 306 WP_001217444.1 RusA family crossover junction endodeoxyribonuclease -
E3152_RS13250 2617681..2618235 + 555 WP_000640035.1 DUF1133 family protein -
E3152_RS13255 2618460..2618657 + 198 WP_000917763.1 hypothetical protein -
E3152_RS13260 2618793..2619506 + 714 WP_000301797.1 helix-turn-helix domain-containing protein -
E3152_RS13275 2619957..2620388 + 432 WP_001302123.1 tellurite resistance protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - nleG7' 2541676..2659399 117723


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(25-66)


Sequences

Toxin        


Download         Length: 71 a.a.        Molecular weight: 7887.47 Da        Isoelectric Point: 9.2654

>T122664 WP_000935259.1 NZ_CP038421:2615179-2615391 [Escherichia coli O157:H7]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 213 bp

>T122664 NZ_CP038421:2615179-2615391 [Escherichia coli O157:H7]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin


Download         Length: 59 bp

>AT122664 NZ_CP038421:c2615224-2615166 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References