Detailed information of TA system TA121310

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 2671855..2672080
• Replicon: chromosome
• Accession: NZ_CP038309
• Organism: Escherichia coli O157:H7 strain Show KS 470-1

Toxin (Protein)

• Gene name: hokW
• Uniprot ID: -
• Locus tag: E4U84_RS13690
• Protein ID: WP_000935259.1
• Coordinates: 2671868..2672080 (+)
• Length: 71 a.a.

Antitoxin (RNA)

Gene name	sokW
Locus tag	-
Coordinates	2671855..2671913 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
E4U84_RS13640	2666920..2667162	+	243	WP_000747948.1	hypothetical protein	-
E4U84_RS13645	2667146..2667571	+	426	WP_000693878.1	Rha family transcriptional regulator	-
E4U84_RS13650	2667640..2668683	+	1044	WP_001262402.1	hypothetical protein	-
E4U84_RS13655	2668676..2669137	+	462	WP_000139447.1	replication protein	-
E4U84_RS13660	2669171..2669887	+	717	WP_000450627.1	DUF1627 domain-containing protein	-
E4U84_RS13665	2669920..2670201	+	282	WP_000603384.1	DNA-binding protein	-
E4U84_RS13670	2670198..2670425	+	228	WP_000699809.1	hypothetical protein	-
E4U84_RS13675	2670418..2670729	+	312	WP_001289673.1	hypothetical protein	-
E4U84_RS13680	2670857..2671075	+	219	WP_000683609.1	DUF4014 family protein	-
E4U84_RS13685	2671077..2671634	+	558	WP_000104474.1	DUF551 domain-containing protein	-
-	2671855..2671913	-	59	-	-	Antitoxin
E4U84_RS13690	2671868..2672080	+	213	WP_000935259.1	type I toxin-antitoxin system Hok family toxin	Toxin
E4U84_RS13695	2672200..2672544	+	345	WP_000756596.1	YgiW/YdeI family stress tolerance OB fold protein	-
E4U84_RS13700	2672666..2672938	+	273	WP_000191872.1	hypothetical protein	-
E4U84_RS13705	2672940..2673989	+	1050	WP_001265229.1	DUF968 domain-containing protein	-
E4U84_RS13710	2674002..2674307	+	306	WP_001217444.1	RusA family crossover junction endodeoxyribonuclease	-
E4U84_RS13715	2674370..2674924	+	555	WP_000640035.1	DUF1133 family protein	-
E4U84_RS13720	2675149..2675346	+	198	WP_000917763.1	hypothetical protein	-
E4U84_RS13725	2675482..2676195	+	714	WP_000301797.1	helix-turn-helix domain-containing protein	-
E4U84_RS13740	2676646..2677077	+	432	WP_001302123.1	tellurite resistance protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	Similar MGE(s) Similar MGE(s) is defined as other TA-related MGE(s) with Mash distance < 0.01 to this MGE. Detail Genome accession Organism MGE type Related TA Coordinates Mash distance View NC_002695 Escherichia coli O157:H7 str. Sakai Prophage TA001008 2157035..2254487 0.006	inside	Prophage	-	nleG7'	2611227..2709194	97967

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (25-66)

Sequences

Toxin

Protein

• Length: 71 a.a.
• Molecular weight: 7887.47 Da
• Isoelectric Point: 9.2654

>T121310 WP_000935259.1 NZ_CP038309:2671868-2672080 [Escherichia coli O157:H7]
MLNTCRLASYVPKGKEKQAMKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Nucleotide

• Length: 213 bp

>T121310 NZ_CP038309:2671868-2672080 [Escherichia coli O157:H7]
ATGCTGAACACATGTAGGTTAGCCTCTTACGTGCCGAAAGGCAAGGAGAAGCAGGCTATGAAGCAGCAAAAGGCGATGTT
AATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAAAGACCTCTGCGAGGTGCGAATCC
GAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA

Antitoxin

Nucleotide

• Length: 59 bp

>AT121310 NZ_CP038309:c2671913-2671855 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Structures

Antitoxin