Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1858814..1858996 | Replicon | chromosome |
Accession | NZ_CP038229 | ||
Organism | Staphylococcus aureus strain MJ163 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | E4J95_RS08910 | Protein ID | WP_001801861.1 |
Coordinates | 1858814..1858909 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1858937..1858996 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E4J95_RS08875 | 1854484..1855110 | + | 627 | WP_045177256.1 | hypothetical protein | - |
E4J95_RS08880 | 1855151..1855492 | + | 342 | WP_045177258.1 | DUF3969 family protein | - |
E4J95_RS08885 | 1855593..1856165 | + | 573 | WP_045177260.1 | hypothetical protein | - |
E4J95_RS08890 | 1856363..1856920 | - | 558 | WP_045177261.1 | ImmA/IrrE family metallo-endopeptidase | - |
E4J95_RS08895 | 1857294..1857470 | - | 177 | WP_000375477.1 | hypothetical protein | - |
E4J95_RS08900 | 1857481..1857864 | - | 384 | WP_000070811.1 | hypothetical protein | - |
E4J95_RS08905 | 1858468..1858611 | - | 144 | WP_001549059.1 | transposase | - |
E4J95_RS08910 | 1858814..1858909 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1858937..1858996 | - | 60 | - | - | Antitoxin |
E4J95_RS08915 | 1859032..1859133 | + | 102 | WP_001791893.1 | hypothetical protein | - |
E4J95_RS08920 | 1859111..1859287 | - | 177 | Protein_1754 | transposase | - |
E4J95_RS08925 | 1859481..1859858 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Prophage | - | lukD / hlgA | 1851924..1891841 | 39917 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T120832 WP_001801861.1 NZ_CP038229:1858814-1858909 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T120832 NZ_CP038229:1858814-1858909 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT120832 NZ_CP038229:c1858996-1858937 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|