Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | CD-RCd/- |
Location | 312361..312576 | Replicon | chromosome |
Accession | NZ_CP037840 | ||
Organism | Clostridioides difficile strain Cd5 |
Toxin (Protein)
Gene name | CD0977.1 | Uniprot ID | Q18AH6 |
Locus tag | E1H28_RS01935 | Protein ID | WP_011861054.1 |
Coordinates | 312361..312504 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RCd11 | ||
Locus tag | - | ||
Coordinates | 312426..312576 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
E1H28_RS01910 (308032) | 308032..308379 | + | 348 | WP_009898409.1 | hypothetical protein | - |
E1H28_RS01915 (308545) | 308545..309063 | + | 519 | WP_009898407.1 | DUF5706 domain-containing protein | - |
E1H28_RS01920 (309127) | 309127..310695 | - | 1569 | WP_009898404.1 | hypothetical protein | - |
E1H28_RS01925 (310689) | 310689..311210 | - | 522 | WP_009898403.1 | ImmA/IrrE family metallo-endopeptidase | - |
E1H28_RS01930 (311912) | 311912..312100 | - | 189 | WP_021358766.1 | hypothetical protein | - |
E1H28_RS01935 (312361) | 312361..312504 | + | 144 | WP_011861054.1 | hypothetical protein | Toxin |
- (312426) | 312426..312576 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312426) | 312426..312576 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312426) | 312426..312576 | - | 151 | NuclAT_0 | - | Antitoxin |
- (312430) | 312430..312576 | - | 147 | NuclAT_1 | - | - |
E1H28_RS01940 (312709) | 312709..312885 | - | 177 | WP_021358767.1 | hypothetical protein | - |
E1H28_RS01945 (313248) | 313248..313637 | + | 390 | WP_021393943.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H28_RS01950 (313731) | 313731..314114 | + | 384 | WP_021358769.1 | BlaI/MecI/CopY family transcriptional regulator | - |
E1H28_RS01955 (314832) | 314832..316223 | + | 1392 | WP_021393934.1 | metallophosphoesterase | - |
E1H28_RS01960 (316371) | 316371..316679 | - | 309 | WP_021395947.1 | LysR substrate-binding domain-containing protein | - |
E1H28_RS01965 (316716) | 316716..317237 | + | 522 | WP_021358772.1 | chromate transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5337.27 Da Isoelectric Point: 10.5719
>T120180 WP_011861054.1 NZ_CP037840:312361-312504 [Clostridioides difficile]
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
MSEFLLGVLASLTASFITYIISRKVKSHSGRSDFELDVKIKLNKKQH
Download Length: 144 bp
>T120180 NZ_CP037840:312361-312504 [Clostridioides difficile]
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
ATGAGCGAATTTTTACTAGGAGTGTTAGCTAGTTTAACAGCTAGCTTTATTACATATATTATTTCCAGAAAAGTAAAAAG
CCACTCTGGCAGGAGTGACTTTGAGCTTGATGTGAAAATCAAGCTTAATAAAAAACAACATTAA
Antitoxin
Download Length: 151 bp
>AT120180 NZ_CP037840:c312576-312426 [Clostridioides difficile]
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
GTAAATTCGTATCAAAAACAAAAAAAGAAACTACAATCTATTAGCCTAGAGTGAAGTTTCATTAACTAAATATTAATGTT
GTTTTTTATTAAGCTTGATTTTCACATCAAGCTCAAAGTCACTCCTGCCAGAGTGGCTTTTTACTTTTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|